DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16898 and JhI-26

DIOPT Version :9

Sequence 1:NP_611452.2 Gene:CG16898 / 37276 FlyBaseID:FBgn0034480 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_523761.2 Gene:JhI-26 / 36819 FlyBaseID:FBgn0028424 Length:439 Species:Drosophila melanogaster


Alignment Length:320 Identity:79/320 - (24%)
Similarity:144/320 - (45%) Gaps:38/320 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LTEEYLQPKLRAYYKDD-QLKVVKVWAKPATEKGQNYMSLMT---RIHVEIQQGDGLLQNRTYII 66
            |.:.|.:.|:..::..| .:.|:          |.:...::|   |..:..:. ||....|..::
  Fly    25 LVDNYSESKVTTFHVGDIDIDVI----------GHSEAFMLTFCYRTTINFEY-DGQKFQRKMVV 78

  Fly    67 KESLSEDCPQAKVFLEY-DVYNREMDMYEFILPKMNELLQEVGLTGKFTADTIF---VDREYRTI 127
            |::.:.. |:....::: .::..|::.|..|||:..:...     |||.|...:   :::.....
  Fly    79 KKTPAMP-PEMYESIQFGPLFTNEINFYTEILPEFQKFTD-----GKFAAPKYYYGELNQHSAVA 137

  Fly   128 ILEDLAQYNY-VNADRVKQLDLAHTKLTLEVLAKFHAASIVVKQRHPE---LLTKSLFIHCFSRD 188
            |||:.|:..: |..||| .|.|.|..:.:..|.:||..:..:|.::||   .||.:|....::.|
  Fly   138 ILENFAEQGWRVTKDRV-GLSLQHAMIAVSYLGRFHGFAYAMKHKNPEKFAQLTDNLKESRYAND 201

  Fly   189 N---KGYTEVYEGVLSAFIRFINEQPVLKKKYGNKLQKIHENIMDYGARTFEVGEQE-LLTLSHG 249
            |   :....:...:..|.......||.:.:::..|...:..:...||.:  .|..:| |.||.||
  Fly   202 NIHPEWKLTMKTSIDRAAKAVATYQPQIDEEFVKKFCFMISDYSQYGRQ--RVAPREPLATLCHG 264

  Fly   250 DCWTTNFLYQYDDASNPQSAVAIDFQFSNFTSPVNDLHQFFTVSLRDEVQD--MESVLVE 307
            |....|..|:|||...||..:..|:|....:||:.||:.|..||:..||:|  .|::..|
  Fly   265 DYVRNNVAYRYDDKEEPQEIMMFDYQTLRVSSPMVDLNVFLAVSIFAEVRDPNFEAIFCE 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16898NP_611452.2 EcKinase 37..322 CDD:281023 74/288 (26%)
JhI-26NP_523761.2 EcKinase 54..330 CDD:281023 73/281 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.