DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16898 and CG9259

DIOPT Version :9

Sequence 1:NP_611452.2 Gene:CG16898 / 37276 FlyBaseID:FBgn0034480 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001260658.1 Gene:CG9259 / 35372 FlyBaseID:FBgn0032913 Length:422 Species:Drosophila melanogaster


Alignment Length:358 Identity:84/358 - (23%)
Similarity:151/358 - (42%) Gaps:52/358 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DDQLKVVKVWAKPATEKGQNYMSLMTRIHVEIQ-QGDGLLQNRTYIIKESLSEDCPQAKVFLEYD 84
            |....:|....||.::....|:.....:||.:: .....::..|:..|.:...:..:.:...::.
  Fly    28 DTGFDIVNYTLKPTSDAPAGYLGSHLYLHVTLKLHNSEEVRQLTFFSKSAPVGNESRMEYLEDFG 92

  Fly    85 VYNREMDMYEFILPKMNELLQEVGLTGKFTADTIFVDREYRTIILEDLAQYNY-VNADRVKQLDL 148
            |:.:|:.:|:.:||.:::...||      .....:.|:  ..:|.|:||...| :.|.|...|..
  Fly    93 VFEKEIAVYQNVLPDLHKACAEV------APKCYYADK--NLLIFENLADQGYRMGAGRDGLLTY 149

  Fly   149 AHTKLTLEVLAKFHAASIVVKQRHPELLT----KSLFIHCFSRDNKGYTEVYEGVLSAFIRFINE 209
            ......|:.||..||.||:.:||..:.:.    ||:..:.:..|          |....:|.:|.
  Fly   150 EQLHCCLKTLAAMHAGSIIQEQRTGQKIAQSQPKSVVENAYPSD----------VSPEHMRMVNF 204

  Fly   210 QP---VLKK------KYGNKLQKIHENIMDYGARTFEVGEQELL---TLSHGDCWTTNFLYQYDD 262
            |.   |||:      ||.:||..:.||..:..:..||..:...:   |:.|||.|..|.::||..
  Fly   205 QNACLVLKEFIKLIPKYQSKLDYVLENFTEKMSFIFEAVKTSDVYQNTILHGDLWANNIMFQYGR 269

  Fly   263 ASN-PQSAVAIDFQFSNFTSPVNDLHQFFTVSLRDEVQDME-SVLVEKYYSDL-----KTNVDTL 320
            ... |.....:|||.:.:..||.|:....|:....|.:|.. |.|:.:||..:     :.::|..
  Fly   270 YGEVPLQCRLVDFQLARYAPPVLDVLTVLTIPTSKEFRDAHLSELLAEYYRFMTEFLKRADLDIA 334

  Fly   321 SY---KGIFPSLQGFQK--QFESRRFMCLLAHL 348
            .:   :..:.|:|.|:.  ..||    ||..||
  Fly   335 RFIPEQTFYESVQKFRSVGLIES----CLFCHL 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16898NP_611452.2 EcKinase 37..322 CDD:281023 71/309 (23%)
CG9259NP_001260658.1 PKc_like 57..328 CDD:304357 68/288 (24%)
APH <252..325 CDD:279908 22/72 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459502
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
54.840

Return to query results.
Submit another query.