DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16898 and CG33509

DIOPT Version :9

Sequence 1:NP_611452.2 Gene:CG16898 / 37276 FlyBaseID:FBgn0034480 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001014494.1 Gene:CG33509 / 3346225 FlyBaseID:FBgn0053509 Length:389 Species:Drosophila melanogaster


Alignment Length:312 Identity:68/312 - (21%)
Similarity:139/312 - (44%) Gaps:45/312 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 PQAKVFLEYD-VYNREMDMYEFILPKMNELLQEVGLTGKFTADTIFVDREYRTIILEDLAQYNYV 138
            ||....|..: ::.:|..:|:.::.|: :.|..|    |::.:.::..::  .::||::....:.
  Fly    67 PQQSAELSKESIFQKESWLYDTLIKKL-QALSNV----KWSPNCVYSRKD--LMVLENIKLKGFT 124

  Fly   139 NADRVKQLDLAHTKLTLEVLAKFHAASIVVKQRHPELLTKSLFIHCFSRDN----------KGYT 193
            :|... :|:....|..::.:|.||:||:|.:.:     ||:...|.:. ||          ..:|
  Fly   125 SAGSA-ELNEVFVKPLIKSIAAFHSASLVYEHQ-----TKTNIGHTYG-DNLLEITVDSEIAWFT 182

  Fly   194 EVYEGVLSAFIRFI------NEQPVLKKKYGNKLQKIHENIMDYGARTFEVGEQELLTLSHGDCW 252
            .....|| |.:|.:      .||..:    |:||..|.|.|.:..|.:    ::....|.|.|.|
  Fly   183 TGLSAVL-AVVRSLAKYQGNREQSFI----GDKLMGIMETIYEQAAPS----KKYRNVLCHRDIW 238

  Fly   253 TTNFLYQYDDASNPQSAVAIDFQFSNFTSPVNDLHQFFTVSL-RDEVQDMESVLVEKYYSDLKTN 316
            ..|..:..:: |.|  |:.||||...:..|.:||:....::| ..:.:.||...::.|::.|..|
  Fly   239 AGNIFFPPEN-SGP--ALLIDFQTCRYAPPASDLNFCLYMNLSSSKRKQMEKQGIDLYHTYLLQN 300

  Fly   317 VDTLSYKGIFPSLQGFQKQFESRRFMCLLAHLFKPVIIYDGTE-VSSDFSSV 367
            :..|..:.:..|.....:.:|..|...::.......::...|: :::||..|
  Fly   301 LSDLGLEELVISKSELLESYEEFRLFGVVYRAVAATVVKVPTDFITNDFKYV 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16898NP_611452.2 EcKinase 37..322 CDD:281023 61/264 (23%)
CG33509NP_001014494.1 PKc_like 63..305 CDD:304357 60/263 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459499
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
65.840

Return to query results.
Submit another query.