DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16898 and CG33510

DIOPT Version :9

Sequence 1:NP_611452.2 Gene:CG16898 / 37276 FlyBaseID:FBgn0034480 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001014493.2 Gene:CG33510 / 3346224 FlyBaseID:FBgn0053510 Length:426 Species:Drosophila melanogaster


Alignment Length:372 Identity:71/372 - (19%)
Similarity:129/372 - (34%) Gaps:112/372 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KDDQLKVVKVWAKPATEK----GQNYMSLMTRIHVEIQQGDGLLQNRTYIIKESLSEDCPQAKVF 80
            |::|..::.....||||.    |: |..|..:..:|.|:.   :|.....:|..:.::.      
  Fly    35 KNEQGVLLNFNIVPATEHTGFLGE-YFHLYFQYQLEDQKD---VQTSRLFVKSVIFQNA------ 89

  Fly    81 LEYDVYNREMDMYEFILPKMNELLQEVGLTGK--------FTADTIFVDREYRTIILEDLAQY-- 135
             ..:.|..:|.:.|..: |:.:||.|:....|        ||...:||.:.     :||:...  
  Fly    90 -NMEFYMEKMGLIEKEI-KLYDLLNELKKFSKHVWSAKCYFTRKDLFVMQN-----VEDMGYVAL 147

  Fly   136 ----NYVNADRVKQLDLAHTKLTLEVLAKFHAASIVVKQRH------------------PEL--- 175
                .::|.:::..:        |:.||..||:||..:::.                  ||:   
  Fly   148 PPGTRFLNENQMGPI--------LKSLATLHASSIAYEKQQGKTIGVEFRKWLKEVSVDPEVEWY 204

  Fly   176 ---LTKSLFIHCFSRDNKGYTEVYEGVLSAFIR-------FINEQPVLKKKYGNKLQKIHENIMD 230
               |...|.:.....|.....|..|.:.....|       .:|..||            |.|:  
  Fly   205 TTGLRAVLAVAAIHPDVLDNPEAQEYIAQELPRCLDKVYCMVNPSPV------------HRNV-- 255

  Fly   231 YGARTFEVGEQELLTLSHGDCWTTNFLYQYDDASNPQSAVAIDFQFSNFTSPVNDLHQFFTVSLR 295
                           ..|.|.|..|..| :.:..:.:.::.:|||...::.|..|.|....::|.
  Fly   256 ---------------FVHRDAWNANVFY-HKEKPHEERSILVDFQLCRYSPPAMDFHLVTYLNLE 304

  Fly   296 D-EVQDMESVLVEKYYSDLKTNVDTLSYKGIFPSLQGFQKQFESRRF 341
            . ..:.|...|:|.||..|   .:.....|:.|    :|:|...:.|
  Fly   305 PFSRKKMIGSLIETYYDAL---AEEFREMGVNP----YQEQLSKQEF 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16898NP_611452.2 EcKinase 37..322 CDD:281023 60/334 (18%)
CG33510NP_001014493.2 CHK 134..329 CDD:214734 43/240 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459500
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
65.840

Return to query results.
Submit another query.