DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16898 and CG33511

DIOPT Version :9

Sequence 1:NP_611452.2 Gene:CG16898 / 37276 FlyBaseID:FBgn0034480 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001014492.2 Gene:CG33511 / 3346223 FlyBaseID:FBgn0053511 Length:415 Species:Drosophila melanogaster


Alignment Length:386 Identity:89/386 - (23%)
Similarity:162/386 - (41%) Gaps:52/386 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KDDQLKVVKVWAKPATEKGQNYMSLMTRIHVEIQ-QGDGLLQNRTYIIKESLSEDCPQAKVFLEY 83
            |.|.:.::.......::....||....::|:|.: :||.......|.||....::.||.:.....
  Fly    21 KKDNVILINSQVDAGSKDLMGYMGEYYKLHLEAEVKGDKKKYFLNYFIKSLPRKNEPQREECERK 85

  Fly    84 DVYNREMDMYEFILPKMNELLQEVGLTGKFTADTIFVDREYR---TIILEDLAQ-YNYVNADRVK 144
            .|:.:|..:|..||||:.          |:....::....|.   .::||||.| |.::.|:...
  Fly    86 GVFQKESALYSQILPKIQ----------KYATKKLYPKCYYSRNDILVLEDLTQDYRHLRANEYY 140

  Fly   145 QLDLAHTKLTLEVLAKFHAASIVVKQRHPELLTKS-----LFIHCFSRDNKGYTE-----VYEGV 199
            .||  |.|:.||.|::.|||||..:::....:.:|     :.:|..| :|..|..     |:...
  Fly   141 TLD--HYKIVLEHLSELHAASIAWEEKENVKIYESYKNVLIELHLDS-NNSWYITGLKAIVFLAA 202

  Fly   200 LSAFIRFINEQPVLKKKYGNKLQKIHENIMDYGARTFEVGEQELLTLSHGDCWTTNFLYQYDDAS 264
            .:...:.:..|..::.|..|.|.|..|.:..  ::|..      ..|.|.|.|..|.:|.::..|
  Fly   203 RNPHFQTMKAQNFIQDKLYNLLTKAEELVAP--SKTIR------NVLCHRDTWDHNIVYYFNKES 259

  Fly   265 N--PQSAVAIDFQFSNFTSPVND-LHQFFTVSLRDEVQDMESVLVEKYYSDLKTNVDTLSYKGIF 326
            :  |.:...:|||.:.:.||..| |...:.|:..:..:.:....:|.||.:|:.::|.|......
  Fly   260 SVLPNACCIVDFQLTQYCSPTLDVLFLLYIVASAEVRRAIYDECLEHYYKNLQHHLDRLGLDKNL 324

  Fly   327 PSLQGFQKQFESRRFMCLLAHLFKPVIIYDGTEVSSDFSSVYKD---TEEGIRFQKAIYAN 384
            .:...|:|:.:..|...|        :|:..||..:..|....:   :||..:|.  .|.|
  Fly   325 ITENNFRKECQRTRLAAL--------VIWALTEPQTKMSPSISNRLRSEEPEKFD--YYLN 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16898NP_611452.2 EcKinase 37..322 CDD:281023 74/302 (25%)
CG33511NP_001014492.2 PKc_like 41..319 CDD:304357 73/298 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459501
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.