DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16898 and CG31974

DIOPT Version :9

Sequence 1:NP_611452.2 Gene:CG16898 / 37276 FlyBaseID:FBgn0034480 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001259800.1 Gene:CG31974 / 33174 FlyBaseID:FBgn0051974 Length:416 Species:Drosophila melanogaster


Alignment Length:420 Identity:89/420 - (21%)
Similarity:173/420 - (41%) Gaps:102/420 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 TEKGQNYMSLMTRIHVEIQQGDGLLQNRTYIIK-ESLSEDCPQAKVFLEYDVYNREMD------M 92
            |:.|.||.|:|..:..:|:..||.:::...|.| ..|:.|       |.:.::..|..      :
  Fly    33 TKPGDNYGSIMLSVQAKIRSADGGIRDLPLIAKLPPLTND-------LYWQIFQPERTCITENAV 90

  Fly    93 YEFILPKMNELLQEVGLT-------------GKFTAD--TIFVDREYRTIILEDLAQYNYVNADR 142
            |:::.|::::|..|.|:.             .:.:.|  ...|||: ..::.|::....|...:|
  Fly    91 YQYLSPELDKLQLESGILPAQIFDGFPRYYGSRVSLDNRATKVDRD-AVLVQENVTTRGYRPGNR 154

  Fly   143 VKQLDLAHTKLTLEVLAKFHAASIVVKQRHPELLTKSL--FIHCF---SRDNKGYTEVYEGVLSA 202
            .:..:||.|.|.|..||::||..|.::.:.|::..:.:  :...|   |..::..||:....:..
  Fly   155 HRPYNLAETVLILHYLAQYHALPIALRLKKPQVYEEYVRPYFKKFDMNSNIDQAETEIMNKEILK 219

  Fly   203 FIRFI--NEQPVLKKKYGNKLQKIHENIMDYGARTFEVGEQELLTLSHGDCWTTNFLYQY---DD 262
            .|:.:  :|:.|      |:::::.:....:.|.. :|.:....||.|||.|..|.:.:|   .:
  Fly   220 DIKLVTSDERDV------NRVKELLDIFQAFQASN-DVDDGPFTTLVHGDLWINNMMLKYGMRGE 277

  Fly   263 ASNPQSAVAIDFQFSNFTSPVNDL-----------------HQFFTVSLRDEVQDMESVLVEKYY 310
            ...|.....:|||.:.:.|.|:|:                 :.|.|:.....:|.:.||      
  Fly   278 EGTPLKVKIVDFQIAQYGSLVHDIIFVLFSSVDVNVLEDNFYNFLTIYYNAFIQTLRSV------ 336

  Fly   311 SDLKTNVDTLSYKGIFPSLQGFQKQFESRRFMCLLAHLFKP-------VIIYDGTEVSSDFSSVY 368
                 ||||.:|     :.:.|.::.:.      .||:..|       ||:.|.:.:..|    |
  Fly   337 -----NVDTSNY-----TYELFLEEVQQ------TAHVQLPHAIFMMKVILADNSTIPKD----Y 381

  Fly   369 KDTEEGIRFQKAIYANERVLKSATKLLAML 398
            ||.:..:     :..|.......||..|:|
  Fly   382 KDVDFSV-----LTKNTGAKTIVTKFEAIL 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16898NP_611452.2 EcKinase 37..322 CDD:281023 71/333 (21%)
CG31974NP_001259800.1 EcKinase 35..337 CDD:281023 67/327 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459332
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.