DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16898 and CG31300

DIOPT Version :9

Sequence 1:NP_611452.2 Gene:CG16898 / 37276 FlyBaseID:FBgn0034480 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_651373.2 Gene:CG31300 / 326132 FlyBaseID:FBgn0051300 Length:422 Species:Drosophila melanogaster


Alignment Length:420 Identity:104/420 - (24%)
Similarity:176/420 - (41%) Gaps:40/420 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PNWLTEEYLQPKLRAYYKDDQLKVVKVWAKPATEKGQNYMSLMTRIHVEIQQGDGLLQNRTYIIK 67
            |.||..::::..|.||....:||||.:...||:.:|.:|.|:|.|...|.....|.. :|..|||
  Fly    18 PAWLNRQFIEEILSAYEDSPELKVVDLKITPASAQGDHYASVMFRTTAECTTAKGKF-SRPLIIK 81

  Fly    68 ESLSEDCPQAKVFLEYDVYNREMDMYEFILPKMNELLQEVGLTGKFTADTIFVDREYRTI-ILED 131
            ....:|..:..:..|..::..|:.||..:||:...:|:|.|...|.....|:...|.|.: |.||
  Fly    82 AMPEQDGHKKDMLSESHLFETEIGMYCQVLPEFERILRESGDDTKLFVPCIYHSLEPRKVMIFED 146

  Fly   132 LA-QYNYVNADR-VKQLDLAHTKLTLEVLAKFHAASIVVKQRHPELLTKSLFIHCFSRDNKGYTE 194
            |. |..||..|| |.|.:|   |.....|||:||.|:...:..|:.| |......|.........
  Fly   147 LVPQGYYVIRDRPVAQEEL---KTAFAKLAKWHAISMKYIKEQPDFL-KEFKYGLFEMPTVKTDP 207

  Fly   195 VYEGVLSAFIRFINEQPVLKK----------KYGNKLQKI----HENIMDYGARTFEVGEQELLT 245
            .....:.:||..::..|.|:|          ||..:||.:    |||..          ......
  Fly   208 FITTGMQSFIEMLDRLPELRKYKPHFEKIKDKYMQRLQAVMKEYHENRK----------SDAFYV 262

  Fly   246 LSHGDCWTTNFLYQYDDASNP-QSAVAIDFQFSNFTSPVNDL-HQFFTVSLRDEVQDMESVLVEK 308
            |.|||....|.:::.:..:.. :..:.:|||.||......|| :..:.:...::.::|...|:..
  Fly   263 LCHGDFHLRNMMFKNNKGTGAHEDTMLVDFQISNLCPITIDLTYSIYMLMEPEQRREMGKDLINH 327

  Fly   309 YYSDLKTNVDTLSYKGIFPSLQGFQKQFESRRFM-CLLAHLFKPVIIYDGTEVSSDFSSVYKDTE 372
            |.:.|...:.::.|.|..|:......:....::. ..|...|.|:|:...:: |...:.:.:|.|
  Fly   328 YLTVLVATLKSIGYPGELPTQAKLWDEIHKNKYYDFFLLSTFLPLILAIKSK-SFKVNDLIQDPE 391

  Fly   373 EGIRFQKAIYANERVLKSATKLLAMLDAKG 402
            .    ::..|..:..:|..:|||...:..|
  Fly   392 T----RQKTYFLDTYVKDVSKLLPKFEQLG 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16898NP_611452.2 EcKinase 37..322 CDD:281023 76/303 (25%)
CG31300NP_651373.2 EcKinase 52..341 CDD:281023 76/303 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459544
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.