DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16898 and CG31975

DIOPT Version :9

Sequence 1:NP_611452.2 Gene:CG16898 / 37276 FlyBaseID:FBgn0034480 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001162840.1 Gene:CG31975 / 319052 FlyBaseID:FBgn0051975 Length:416 Species:Drosophila melanogaster


Alignment Length:417 Identity:96/417 - (23%)
Similarity:169/417 - (40%) Gaps:87/417 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 TEKGQNYMSLMTRIHVEIQQGDGLLQNRTYIIKESLSEDCPQAKV----------FLEYDVYNRE 89
            |:.|.||.|::..||..:|:.:|          ||..|.. .|||          |........|
  Fly    34 TKPGDNYGSVLLAIHARLQKSNG----------ESFEEQL-VAKVPPIDPKYWQFFQPEQTCLTE 87

  Fly    90 MDMYEFILPKMNELLQEVGLTGK---------------FTADTIFVDREYRTIILEDLAQYNYVN 139
            ..:|:.:.|.:..|..|.|:..:               ..:::..||:. ..::||:|....||:
  Fly    88 NAVYKILAPALATLQDEAGVPDESQFKGFPRFYGCRESLESNSSKVDQN-AVLVLENLRSSGYVS 151

  Fly   140 ADRVKQLDLAHTKLTLEVLAKFHAASIVVKQRHPELLTKSLFIHCFSRDNKGYTEVYEGVLSAFI 204
            ..|:|..|||||.|.|:.:|:|||.|:.::...||:..:.  :..|.:....:.|..|.      
  Fly   152 GQRLKAFDLAHTLLALKYMAEFHALSLALRILRPEVFREQ--VRPFFKKFDWHAEAPEW------ 208

  Fly   205 RFINEQPVLKKKYGNKLQKIHENIMDYGARTFEVGEQ--ELL------------TLSHGDCWTTN 255
                 :.|:|.:....:::...|.....||..|:.:|  |.|            ::.|.|.|..|
  Fly   209 -----KSVMKAETLEDIRRATNNDSRLVARMKELSDQFFEFLAAAPDRPDGPFTSIIHCDFWINN 268

  Fly   256 FLYQYDDASNPQSAVAIDFQFSNFTSPVNDLHQFFTVSLRDEVQDME-SVLVEKYYSDLKTNVDT 319
            .:::|.....|.....||||.:.:.|.|:|:..|...|:...:.::| ..::|.||...:..:..
  Fly   269 IMFRYGPTGTPVELKIIDFQTAQYDSVVHDIISFLLSSVDTAILEVEFEHMLEAYYEAFERCLRR 333

  Fly   320 LSYKGIFPSLQGFQKQFESRRFMCLLAHLFKPVIIYDGTEVSSDFSSVYKDTEEGIRFQKAIYAN 384
            :..|....:.:.|  :.|.:|    :|::..|..|:....:.:| |::..|:|          |.
  Fly   334 VGAKLEVHTFKEF--RLEVKR----VAYIQVPHAIFMTRFILAD-SALIGDSE----------AE 381

  Fly   385 ER-----VLKSATKLLAMLDAKGVLNL 406
            ||     |||:............:|||
  Fly   382 ERPKLTDVLKNTGSERISRKLSQILNL 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16898NP_611452.2 EcKinase 37..322 CDD:281023 75/324 (23%)
CG31975NP_001162840.1 EcKinase 36..335 CDD:281023 75/323 (23%)
APH <214..329 CDD:279908 26/114 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459331
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.