DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16898 and CG31436

DIOPT Version :9

Sequence 1:NP_611452.2 Gene:CG16898 / 37276 FlyBaseID:FBgn0034480 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_733096.1 Gene:CG31436 / 318734 FlyBaseID:FBgn0051436 Length:420 Species:Drosophila melanogaster


Alignment Length:431 Identity:112/431 - (25%)
Similarity:189/431 - (43%) Gaps:57/431 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PNWLTEEYLQPKLRAYYKDDQLKVVKVWAKPATEKGQNYMSLMTRIHVEIQQGDGLLQNRTYIIK 67
            |.||..|::...|.....:..:||:.:...||:.||.:|.|:|.|..|:.....|..| ::.|||
  Fly    18 PEWLNSEFMARVLEGNELEAAVKVIDLTFSPASAKGDHYASIMFRARVKYTNRKGEFQ-KSLIIK 81

  Fly    68 ESLSEDCPQAKVFLEYDVYNREMDMYEFILPKMNELLQEVGLTGKFTADTIFVDRE-YRTIILED 131
            .....:..:..:.....::..||.:|..:||:...:|::||...:...:.|:...| ::.:|.||
  Fly    82 TMPEAEGHKKDMLGGSPIFETEMGLYTKVLPEFERILRQVGDDTQLYVNCIYHSLEPHQVLIFED 146

  Fly   132 LAQYNY-VNADRVKQLDLAHTKLTLEV------LAKFHAASIVVKQRHPELL---TKSLF--IHC 184
            ||:..| |..||...||        |:      |||:||.|:.|:...||.|   |..||  .|.
  Fly   147 LAEMGYIVLRDRDATLD--------EIRRIYFKLAKWHAVSLKVQNEQPEFLESYTHGLFEMPHV 203

  Fly   185 ----FSRDNKGYTEVYEGVLSAFIRFINEQPVLKKKYGNKLQKIHENIM-DYGARTFE------- 237
                |.|..          :..|:..:.::|.|     ||.:...|:|. |:..|..|       
  Fly   204 LNDPFMRTG----------MEFFVELLGKEPEL-----NKYKPYFESIKDDFLERLVEEWKDIRK 253

  Fly   238 -VGEQELLTLSHGDCWTTNFLYQYDDASNPQSAVAIDFQFSNFTSPVNDLHQFFTVSLRDEVQ-D 300
             ..:.|...|.|||....|.::::.|..:.:..:.:|||.||......||.....:.|..|.: :
  Fly   254 SQKKDEYWVLCHGDLHLRNIMFKHKDTVSLEDCMLLDFQISNLFPLTFDLLYSIYMLLEPEHRWN 318

  Fly   301 MESVLVEKYYSDLKTNVDTLSYKGIFPSLQGFQKQFESRRFM-CLLAHLFKPVIIYDGTEVSSDF 364
            ....|:..|.|.|:..:..:.|||:.||..|..|:....::. ..|...|.| :::...:.|.||
  Fly   319 NWDDLINYYISVLQDVLKKIGYKGVMPSQSGLWKRLHQHKYYEFFLISTFLP-LMWALRDKSVDF 382

  Fly   365 SSVYKDTEEGIRFQKAIYANERVLKSATKLLAMLDAKGVLN 405
            ..:.::.|:    ::....::..:|..|.|||.||..|:|:
  Fly   383 GDLLQNEEK----RRKCSFSKGYIKEVTILLARLDQLGLLH 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16898NP_611452.2 EcKinase 37..322 CDD:281023 80/311 (26%)
CG31436NP_733096.1 EcKinase 52..340 CDD:281023 80/311 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459548
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.