DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16898 and H37A05.2

DIOPT Version :9

Sequence 1:NP_611452.2 Gene:CG16898 / 37276 FlyBaseID:FBgn0034480 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_506379.1 Gene:H37A05.2 / 186806 WormBaseID:WBGene00010426 Length:419 Species:Caenorhabditis elegans


Alignment Length:355 Identity:67/355 - (18%)
Similarity:138/355 - (38%) Gaps:79/355 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 TEKGQNYMSLMTRIHVEIQQGDGLLQNRTYIIKESLSEDCPQAKVFLEYDVYNREMDMYEFIL-- 97
            ||..||   |..||.|::.....|....|.:..|:...:..::...|..:::|||:|||..|:  
 Worm    66 TENAQN---LPDRIAVKMSSELSLYNFSTLVSSETWDIEKMKSMTSLVKELHNREVDMYRIIMRE 127

  Fly    98 ----PKMNEL----------------------LQEVGLTGKFTADTIFVDREYRTIILEDLAQYN 136
                |.:|.|                      |..||:....:.:.|:.       :::.:|.::
 Worm   128 KPACPTVNVLSLEAFTELSPLKAYIISEYIPNLHHVGMNDCISIEEIWA-------VVDGIAAFS 185

  Fly   137 ----YVNADRVKQLDLAHTKLTLEVLAKFHAASIVVKQRHPELLTKSLFIHCFSRDNKGYTEVYE 197
                .::.|..|:..:.  ::.:|...|:     ....:.|:.:.|:|.:..    ...|.|..|
 Worm   186 AMGESMSEDEKKKSTIG--EIYIEEAVKY-----FFDDQSPDNMRKNLIMIL----GVAYEEKVE 239

  Fly   198 GVLSAFIRFINEQPVLKKKYGNKLQKIHENIMDYGARTFEVGEQELLTLSHGDCWTTNFLYQYDD 262
            ..:..|..:..         .:::||.:..:..:      :|...:  |.|.|.|.:|.|:....
 Worm   240 EAMDIFDLYCG---------SSEIQKNYSRVSAF------LGHSPV--LMHSDIWPSNLLFSLSS 287

  Fly   263 ASNPQSAVAIDFQFSNFTSPVNDLHQFFTVSL-RDEVQDMESVLVEKYYSDLKTNVDTLSYKGIF 326
            .:..:....||||.::.:||..|:.......| :.:.:.::|.::::||.....::.|.:     
 Worm   288 ENKLEFKALIDFQTASLSSPGLDVGCLTVTCLSKKDRRTVQSEILDRYYKSFVKSLKTPN----- 347

  Fly   327 PSLQGFQKQFESRRFMCLLAH--LFKPVII 354
             |:...::|.|....:|..|.  |..|.|:
 Worm   348 -SIPYTREQLEDSYELCFPASVILMLPFIL 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16898NP_611452.2 EcKinase 37..322 CDD:281023 57/317 (18%)
H37A05.2NP_506379.1 DUF1679 3..409 CDD:369592 67/355 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I4082
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.