DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16898 and F48G7.12

DIOPT Version :9

Sequence 1:NP_611452.2 Gene:CG16898 / 37276 FlyBaseID:FBgn0034480 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_503277.2 Gene:F48G7.12 / 186000 WormBaseID:WBGene00018623 Length:435 Species:Caenorhabditis elegans


Alignment Length:256 Identity:57/256 - (22%)
Similarity:105/256 - (41%) Gaps:63/256 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 VYNREMDMYEFILPKMNE----LLQEVGLTGKFTAD-------------TIFVDREYRTIILEDL 132
            ::|||:::|: |..|.|:    |..::....||.|:             .:.|...|..:...:|
 Worm   121 LHNREVNLYK-ITEKWNKNETMLSPKIYFYKKFDAENKTKGILGMEFDGNVTVRHIYCNVKPREL 184

  Fly   133 AQYNYVNADRVKQLDLAH-TKLTLEVLAKFHAASIVVKQRHPELLTKSLFIHCFSRDNKGYTEVY 196
              |..:.:....|....| ||..:|.:     :.:.|||....|:           :|:|....|
 Worm   185 --YPVLRSIATLQAGSLHLTKDEIESI-----SGLDVKQMMGSLM-----------NNEGMKGFY 231

  Fly   197 EGVLSAFIRFINEQPVLKKKYGNKLQKIHENIMDYGARTFEVG---------EQELLTLSHGDCW 252
            |..     |.||.:.:.:|.  |.::...:.:::     ||:.         :::::.  |||.|
 Worm   232 EQT-----REINRKRLTEKT--NVVEAFGQEVVN-----FELACNLNKYIGIKRDVMV--HGDLW 282

  Fly   253 TTNFLYQYDDASNPQSAVAIDFQFSNFTSPVNDLHQFF--TVSLRDEVQDMESVLVEKYYS 311
            ..|.|::..|......:..||:|..:..:|..||.:.|  |:|..|.....|. |:||:|:
 Worm   283 AANILWKEKDEGTFSVSKVIDYQLIHMGNPAEDLVRLFLSTLSGADRQAHWER-LLEKFYT 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16898NP_611452.2 EcKinase 37..322 CDD:281023 57/256 (22%)
F48G7.12NP_503277.2 DUF1679 10..421 CDD:369592 57/256 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 62 1.000 Domainoid score I6837
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.