DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16898 and F20D6.5

DIOPT Version :9

Sequence 1:NP_611452.2 Gene:CG16898 / 37276 FlyBaseID:FBgn0034480 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_505104.3 Gene:F20D6.5 / 184724 WormBaseID:WBGene00017635 Length:376 Species:Caenorhabditis elegans


Alignment Length:319 Identity:73/319 - (22%)
Similarity:137/319 - (42%) Gaps:58/319 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 EIQQGDGLLQNRTYIIKESL---------SEDCPQAKVFLEYD----VYNREMDMYEFI------ 96
            ::..|.|:|.....:.:|..         ..:..::::|:..|    ::|.|:|.|.|:      
 Worm    25 DVGTGKGMLSCVQLVFEEQYGGNVILKIPGAEAARSRLFIGDDTFCKLHNTEVDAYTFLQKFSDK 89

  Fly    97 ---LPKMNELLQEVGLTGKFTADTI---FVDREYRTIILEDLAQYNYVNADRVKQLDLAHTKLTL 155
               .||:.| |:::.:    :.|.|   .:..||.:.|.. |..||.:..|.:.:        .:
 Worm    90 NISYPKIYE-LEKMDI----SVDPIKQGHIIMEYMSGITH-LYCYNNLKPDELIE--------PV 140

  Fly   156 EVLAKFHAASIVVKQRH----PELLTKSLFIHCFSRDNKG-YTEVYEGVLSAFIRFINEQPVLKK 215
            :.||:||:....:.:..    |.....|.|...|::.||. :...::|.||.::.....:..:|:
 Worm   141 KNLARFHSIGAELDEEEGSNVPRDFLSSWFTTLFTQQNKNTFIGNWKGDLSDWLPSKVARDTIKE 205

  Fly   216 KYGNKLQKIHENIMDYGARTFEVGEQELLTLSHGDCWTTNFLYQ-YDDASNPQSAVAIDFQFSNF 279
            ..|....:|...:.:....|   |.||:  |.|||....|.||: :.|.|....|: :|||..|:
 Worm   206 LDGLLTPEIFLKLNNDCQLT---GVQEV--LCHGDYSFHNLLYEKHCDGSYKFRAI-VDFQSVNW 264

  Fly   280 TSPVNDLHQFFTVSL--RDEVQDMESVLVEKYYSDL----KTNVDTLSYKGIFPSLQGF 332
            .:...||.:.|..::  :|. :|.|..|::.||.:|    |.||...:::.:..|...|
 Worm   265 GNAAQDLSRLFVTAMSGKDR-RDSEDRLLKIYYDELIKVSKGNVAPFTWEQLKQSYTRF 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16898NP_611452.2 EcKinase 37..322 CDD:281023 71/307 (23%)
F20D6.5NP_505104.3 PKc_like 11..369 CDD:389743 73/319 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.