DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16898 and E02C12.6

DIOPT Version :9

Sequence 1:NP_611452.2 Gene:CG16898 / 37276 FlyBaseID:FBgn0034480 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_505426.2 Gene:E02C12.6 / 183987 WormBaseID:WBGene00017092 Length:419 Species:Caenorhabditis elegans


Alignment Length:399 Identity:74/399 - (18%)
Similarity:134/399 - (33%) Gaps:130/399 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 EKGQNYMSLMTRIH-VEIQQGDGLLQNRTY-IIKESLSEDCPQAKVFLEYDVYNREMDMYEFILP 98
            ||.:.:..|..:.| :|::         || ::.:....|.|..||: ....:|.|.|:..:::.
 Worm   101 EKLKKFSKLTRKSHNIEVE---------TYKVLTKFNHPDIPYTKVY-SLKPFNGEDDLKGYLIT 155

  Fly    99 KMNELLQEVGLTGKFTADTI------------------------FVDREYRTIILEDLAQYNYVN 139
            .....:..:.......||.|                        |:..::..::.||.    :.:
 Worm   156 DFIPNVHVIEAYKSIPADNIAATIRGIATFSALAEHLEREEQKSFMSTDFLELLFEDF----FTD 216

  Fly   140 ADRVKQLDLAHTKLTLEVLAKFHAASIVVKQRHPELLTKSLFIHCFSRDNKGYTEVYEGVLSAFI 204
            |:..|:.:...||..              .|:|.|.::|                        .|
 Worm   217 AELSKKFEALKTKFE--------------GQQHAEKVSK------------------------LI 243

  Fly   205 RFINEQPVLKKKYGNKLQKIHENIMDYGARTFEVGEQELLTLS----HGDCWTTNFLYQYDDASN 265
            :.......|.|||        .||.|            ||.|.    |||.|.:|.::..|::..
 Worm   244 KVFAHYKALVKKY--------TNISD------------LLGLKPVFIHGDLWQSNIMFTLDNSKK 288

  Fly   266 PQSAVAIDFQFSNFTSPVNDLHQFFTVSL-RDEVQDMESVLVEKYYSDLKTNVDTLSYKGIF-PS 328
            .:....||:|..:...|..||.:.....| ..|.::..:.|::.|:.         :|..:| ..
 Worm   289 LKLEAIIDWQSVSRIPPGIDLSRIMLGCLSAQERRERGTELLKLYHE---------TYAKVFGKE 344

  Fly   329 LQGFQKQFES-RRFMCLLAHLFKPVI--IYDGTEVSSDFSSVYKDTEEGIRFQKAIYANERVLKS 390
            |..||:..:| ..:..::|.|..|.:  ..|..::|.:              :||..|.|..||.
 Worm   345 LFTFQELQDSYNLYAPMMAMLILPSLSSFLDSAQISKE--------------EKAAAAEEVNLKE 395

  Fly   391 ATKLLAMLD 399
            ...:..:||
 Worm   396 VAMIEDILD 404

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16898NP_611452.2 EcKinase 37..322 CDD:281023 54/315 (17%)
E02C12.6NP_505426.2 DUF1679 3..410 CDD:369592 74/399 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2AMXB
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X109
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.