DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16898 and dhs-27

DIOPT Version :9

Sequence 1:NP_611452.2 Gene:CG16898 / 37276 FlyBaseID:FBgn0034480 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_508591.3 Gene:dhs-27 / 180632 WormBaseID:WBGene00000990 Length:320 Species:Caenorhabditis elegans


Alignment Length:267 Identity:51/267 - (19%)
Similarity:95/267 - (35%) Gaps:76/267 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 LLTKSLFIHCFS-RDNKGY--------TEVYEGVLSAFIRFINEQPVLKKKY--GNKLQKIHENI 228
            ::.||:.:|..: :.:..|        |...:|:..|:|..:.:...|||.|  |..:.|::.. 
 Worm    27 IMCKSVLVHFITPKHDLDYLKDTWTVITGGTDGIGKAYIEELCKTRGLKKFYLIGRNIDKLNNT- 90

  Fly   229 MDYGARTFEVGEQELLTLSHG---DCWTTNFLYQYDDASN-PQSAVAIDFQ------------FS 277
                       ::||:. .||   .|...:|  :.||.|. |:....:|..            ..
 Worm    91 -----------KKELVE-QHGCEVMCHVHDF--EKDDLSALPKDLETLDVGILINCAGIAPHIIG 141

  Fly   278 NFTS-PVNDLHQFFTVSLRDEVQDMESVL--VEKYYSDLKTNVDT------LSYKGIFPSLQGFQ 333
            ..|. |.....:...|:|...|:..|.:|  :.|....:..|:.:      |.|...:|:.:...
 Worm   142 TLTELPEGLASKILRVNLMSAVKMTEMILPNMVKKKRGIIVNISSMTGWRPLPYLSSYPASKAAL 206

  Fly   334 KQFESR----------RFMCLLAHLFKPVIIYDGTEVSSDFSSVYKDTEEGIRFQKAIYANERVL 388
            ..|...          |..||:     |:::  .|:|:|     |:..|....|   :...|...
 Worm   207 SFFSDSLSDEYRGTGIRVQCLI-----PMLV--ATKVAS-----YEAEEANNIF---VVTPENFA 256

  Fly   389 KSATKLL 395
            |.|.:::
 Worm   257 KQAVRII 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16898NP_611452.2 EcKinase 37..322 CDD:281023 35/182 (19%)
dhs-27NP_508591.3 17beta-HSD1_like_SDR_c 48..294 CDD:187614 47/246 (19%)
adh_short 50..234 CDD:278532 38/205 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.