DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG16898 and D1044.1

DIOPT Version :9

Sequence 1:NP_611452.2 Gene:CG16898 / 37276 FlyBaseID:FBgn0034480 Length:407 Species:Drosophila melanogaster
Sequence 2:NP_001367707.1 Gene:D1044.1 / 175763 WormBaseID:WBGene00017027 Length:376 Species:Caenorhabditis elegans


Alignment Length:290 Identity:63/290 - (21%)
Similarity:111/290 - (38%) Gaps:68/290 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 EDLAQYNYVNADRVKQLDLAHTKLTLEVLAKFHAASIVVKQRHPELLTKSLFIHCFSRDNKGYTE 194
            ||.:...| :.|.|...|.:.....||.||.|||..|.:....|                   .:
 Worm   133 EDYSGKVY-SIDFVPGFDESQVLQLLEALAHFHAKIIEISDEIP-------------------WK 177

  Fly   195 VYEGVL--SAFIRFINE-----QPVLKKKYGNKLQKIHENIMDYGARTFEVGEQEL---LTLSHG 249
            .||.||  :|:||.::.     :.:...:...::|::.....:.|.|..|...::|   |.:.|.
 Worm   178 NYENVLYDAAYIRMLHNDTLDFEKLCPAELSGRIQEVKHAFDEDGVRNSEKKNEKLGMPLVICHN 242

  Fly   250 DCWTTNFLYQYDDASNPQSAVAIDFQFSNFTSPVN-DLHQFFTVSLRDEVQDMESV-LVEKYYSD 312
            |...:|.|:..:..   :....||||..: ..||: |:.:...:.|..|.:...:. .:..||:.
 Worm   243 DLNASNVLWNNETG---KIQAFIDFQHVS-KGPVSFDIIRILCLGLSVENRRANTQRYLNHYYTT 303

  Fly   313 LKTNVDTLSYKGIFPSLQGFQKQFESRRFMCLLAHLFKPVIIYDGTEVSSDFS-----SVYKDTE 372
            .|::..|..:.        |.:..||.|     .|       ::....:|.||     .:|||  
 Worm   304 FKSHFSTAPFT--------FSQLEESYR-----TH-------FNFVNATSLFSLSYYYKMYKD-- 346

  Fly   373 EGIRFQKAIYANERVLKS---ATKLLAMLD 399
            |.:..:..  |:||..|:   ..:.:.:||
 Worm   347 ESLDLKSG--ADEREHKAQEILRRTIGILD 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG16898NP_611452.2 EcKinase 37..322 CDD:281023 45/203 (22%)
D1044.1NP_001367707.1 CHK 130..308 CDD:214734 44/198 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.