DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8654 and Slc22a23

DIOPT Version :10

Sequence 1:NP_611451.1 Gene:CG8654 / 37275 FlyBaseID:FBgn0034479 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_001028339.1 Gene:Slc22a23 / 73102 MGIID:1920352 Length:689 Species:Mus musculus


Alignment Length:87 Identity:22/87 - (25%)
Similarity:29/87 - (33%) Gaps:38/87 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 HQHQH----------------------SYGGFE---YEYATGGGG-------VGGSIGGLGSGGY 96
            |:|.|                      :||.::   |.|..|.||       ..|..||:|.||.
Mouse     2 HKHHHCCKCPECYEVTRMAALRRMDAPAYGEWQPEPYGYPAGYGGGQTLPPQTSGGGGGMGGGGT 66

  Fly    97 LAASAGSAPVDNILISLNGGNG 118
            |..|.|.      ::|..|..|
Mouse    67 LGRSKGK------MMSAGGPGG 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8654NP_611451.1 MFS_SLC22 82..477 CDD:340875 14/44 (32%)
Slc22a23NP_001028339.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..55 10/52 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 162..188
MFS_SLC22A23 187..608 CDD:341002
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.