DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8654 and SLC22A15

DIOPT Version :10

Sequence 1:NP_611451.1 Gene:CG8654 / 37275 FlyBaseID:FBgn0034479 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_060890.2 Gene:SLC22A15 / 55356 HGNCID:20301 Length:547 Species:Homo sapiens


Alignment Length:81 Identity:17/81 - (20%)
Similarity:37/81 - (45%) Gaps:13/81 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   831 EENIILSIRLPLDPKLTPMQLLKMEKDQCTRILETISHQINTQYVELSAHRLLSIFKMA---EVQ 892
            :|..:|.::|   .::..:|..::.:.:....::...:|..|.   .|..|||.:.:.|   .:.
Human    54 QEKCVLRLQL---KRMDSLQKQELRRPKIHGAVQVSPYQPPTL---ASLQRLLWVRRTATLTHIN 112

  Fly   893 IVWPEV----SYARRN 904
            .|||.:    :||.|:
Human   113 EVWPNLFLGDAYAARD 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8654NP_611451.1 MFS_SLC22 82..477 CDD:340875
SLC22A15NP_060890.2 MFS_SLC22A15 71..469 CDD:340935 13/61 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 522..547
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.