DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8654 and CG12783

DIOPT Version :9

Sequence 1:NP_001246441.1 Gene:CG8654 / 37275 FlyBaseID:FBgn0034479 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_001262644.2 Gene:CG12783 / 42019 FlyBaseID:FBgn0038448 Length:493 Species:Drosophila melanogaster


Alignment Length:466 Identity:94/466 - (20%)
Similarity:157/466 - (33%) Gaps:133/466 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 NLTCESKQLASLSQSIVMLGILFGSILFGMFADRYGRRPAFLTCCFMQLITGLIVCVSPYYWFYC 163
            :|.....|||||:.:..| ||:..|..:|...|:.|||...|....:..:..|....:..:..:.
  Fly    48 DLRMNEAQLASLTAAGFM-GIICSSYFWGYITDKKGRRWTLLRTITISNLCSLASMFTVTFTGFF 111

  Fly   164 LFRFLVAVATAGTMTTSFVLLMEIVGPKKREMVAILYQIPFNIGHASLALFAY------------ 216
            :.||:..:..||....:...|.|..  ..|.||..:..:....|.|.::..|:            
  Fly   112 VMRFITCIFVAGPSFVAATYLSEFC--SHRIMVRSITHLYMFTGFAMISCPAWATLFLSSGLIEF 174

  Fly   217 --------FIREWRWFQFSITIFSIVFVIYIWLVPESPRWLFTTGKLDKSIKILEKIAKCNKAPT 273
                    .:|.||.......:..:|..:.:.|:||||::|...|:..:.:..:|.|::.|    
  Fly   175 EEKLVGSLTLRPWRVLGCLYILPGVVAFLLLLLLPESPKFLLMIGETKRGLDTMEWISRKN---- 235

  Fly   274 ETIRPEIEAAYGALAARQ---PVKK------------GTVVDLFRTPYMRIKTIFMANNWLVVCM 323
             |.|...|.....|.|.|   .||:            ...:.|.|.||        ...:..|||
  Fly   236 -TGRTLSEDQMKRLLAYQEHVQVKRRKEHQNFFRSMLDDAMPLVRKPY--------GGYFTCVCM 291

  Fly   324 VYYGTAQYVSALGGNIFISNAIAAGVGI----------------PGTCLCALM-----TKYLGRK 367
            |              :|:...:..|:||                .|...|.::     ..::..:
  Fly   292 V--------------MFVLGLLTHGLGIWYTAMRNRCNMRQGNTNGMTFCQVLFVPETGPFIETE 342

  Fly   368 KTLLL--------SNGCSALGLIL----------LACLSTQAEAV--RVTCATIG---LFGAS-- 407
            ..|.:        .|....||.:.          |.|:..:...|  .|..:|.|   :|..:  
  Fly   343 SDLDVVCSDSFKGFNDSFVLGFVYVVLYNISWASLFCVHKKVMFVFSLVASSTFGFLLIFATNHM 407

  Fly   408 ---------ITFPNVY--LYGGELF---PTVVRSSGVGLCSMVGRIGSIVAPLIV--------DL 450
                     |.||.:.  |.||.|.   ||.:|...:.:..|..|.|:....::|        :|
  Fly   408 LQLFSLVFLIAFPGIIIGLLGGSLLVFVPTYLRGKALCISLMWCRCGAAFGAMLVGSKIQYNCEL 472

  Fly   451 AAYGLWVAPLI 461
            ....:.:.|||
  Fly   473 FLLAISILPLI 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8654NP_001246441.1 SP 85..487 CDD:273317 94/466 (20%)
MFS 87..477 CDD:119392 94/466 (20%)
CG12783NP_001262644.2 synapt_SV2 <2..>310 CDD:130366 63/291 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.