DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8654 and CG14856

DIOPT Version :9

Sequence 1:NP_001246441.1 Gene:CG8654 / 37275 FlyBaseID:FBgn0034479 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_650391.1 Gene:CG14856 / 41790 FlyBaseID:FBgn0038261 Length:557 Species:Drosophila melanogaster


Alignment Length:551 Identity:131/551 - (23%)
Similarity:222/551 - (40%) Gaps:88/551 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 DPIISQIGDFRRYQLFFFFIVLLCKFGTGWH-----TLGHI-----------------FLAAPTP 64
            |.|:.:.||..|||.....:..|..|....|     .:|.:                 ..|...|
  Fly     6 DEILVKCGDSHRYQYMLLALYGLLMFIVSRHYFAQNVIGFVPDHWCYHEQLENRSYAEIAAIYAP 70

  Fly    65 L---SCKT--------ENVTDPCSDECSE--TEFDTSVFQSTIITEWNLTCESKQLASLSQSIVM 116
            .   ||..        .|.| ..|:.|:.  ..:|...........|  .|:....|.:.||:..
  Fly    71 FKRPSCTRLASINMDGSNAT-ASSEPCNRWIYHYDHGFISMNADLNW--VCDDAYKARVGQSLFF 132

  Fly   117 LGILFGSILFGMFADRYGRRPAFL--TCC-FM---------QLITGLIVCVSPYYWFYCLFRFLV 169
            :|.:.|::|||:..||.||..|.:  .|| |:         .|:|            :...||:.
  Fly   133 VGSMCGTLLFGLLGDRIGRIKAVVLANCCGFLGDSATIFAETLLT------------FSASRFVS 185

  Fly   170 AVATAGTMTTSFVLLMEIVGPKKREM-VAILYQIPFNIGHASLALFAYFIREWRWFQFSITIFSI 233
            .:|........|:|::|.|.|..|.: :.:...:.:.:|....:....::..||.|.....:..:
  Fly   186 GLAAEANSYLMFILVLEYVSPTMRSVGLNLTMCVFYGLGMICASWQGVWLGSWRSFMVWTALPQL 250

  Fly   234 VFVIYIWLVPESPRWLFTTGKLDKSIKILEKIAKCNK-----APTETIRPEIEAAYGALAARQPV 293
            :...:.:|:.||.:||.|....|.:...|.::||.|:     |..|..|...:.......::..:
  Fly   251 LVTGFYFLIQESAQWLVTRQDFDGAELRLRRVAKFNRRDVSEADYELFRQHCKTKESEARSQMSM 315

  Fly   294 -KKGTVVDLFRTPYMRIKTIFMANNWLVVCMVYYGTAQYVSALGGNIFISNAIAAGVGIPGTCLC 357
             |:..::|.|:.|.:|::.|::...:.:|.:.|...::.|..|..:.|:..::.|....|.....
  Fly   316 QKQARLIDSFKLPRLRLRLIYVTVVFSIVTLCYNTMSRNVEGLSISPFVMFSLFALTLPPSGIFQ 380

  Fly   358 ALMTKYLGRKKTLLLSNGCSALGL------ILLACLSTQAEAVRVTCATIGLFGASITFPNVYLY 416
            ..:.|:.|||.|.::|  .:|.||      ||||..:..:..|.|....:..||.|:|..:....
  Fly   381 TQVQKHFGRKFTSVVS--MTATGLMTATTGILLAFWTQHSATVMVCLLLMCRFGISVTTGSTMQI 443

  Fly   417 GGELFPTVVRSSGVGLCSMVGRIGSIVAPLIVDLAAYGLWVAPLIFGIFSILAMLGTIFLPETRG 481
            ..||.||.|||||:.:..:.....|.::|.|:.|..|....:.:|..|..:::....:.|.|||.
  Fly   444 STELMPTCVRSSGLAVIHVTAAALSFISPFILHLDTYFRAASSIITCILLLVSAWICLLLSETRN 508

  Fly   482 TPLPETLEDGETFGR-----------KKKDQ 501
            ..||.||.:||.||:           ||.||
  Fly   509 KKLPLTLAEGEEFGKGERMFDFMRSFKKADQ 539

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8654NP_001246441.1 SP 85..487 CDD:273317 102/426 (24%)
MFS 87..477 CDD:119392 95/414 (23%)
CG14856NP_650391.1 2A0119 13..514 CDD:273328 119/517 (23%)
MFS 129..503 CDD:119392 91/387 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X24
33.010

Return to query results.
Submit another query.