DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8654 and CG4324

DIOPT Version :9

Sequence 1:NP_001246441.1 Gene:CG8654 / 37275 FlyBaseID:FBgn0034479 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_001286807.1 Gene:CG4324 / 37830 FlyBaseID:FBgn0034956 Length:478 Species:Drosophila melanogaster


Alignment Length:471 Identity:120/471 - (25%)
Similarity:198/471 - (42%) Gaps:79/471 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 FGTGWHTLGHIFLAAPTPLSCKTENVTDPCSDECSETEFDTSVFQSTIITEWNLTCESKQLASLS 111
            ||.||.   |:.|:....|...::::....          .|:...::..|||:|  ..|.||::
  Fly    49 FGFGWF---HVKLSLLVGLCWMSDSMEMAI----------LSILGPSLFCEWNVT--KFQQASVT 98

  Fly   112 QSIVMLGILFGSILFGMFADRYGRRPAFLTCCFMQLITGLIVCVSPYYWFYCLFRFLVAVATAGT 176
             ::|.||::..|..:...::||||:.|......:.::..::..|:|.|.:....|.||..| .|.
  Fly    99 -TVVFLGMMLSSSFWTQLSNRYGRKSALTLFGVLLVLYSILSSVAPSYAWLLTLRGLVGFA-IGC 161

  Fly   177 MTTSFVLLMEIVGPKKREMVAILYQIPFNIG---HASLALFAYFIREWR-WFQFSITIFSIVFVI 237
            :..|..|..|.:..|.:....:|....:.:|   ...|||..|....|| ....|.|...|..::
  Fly   162 VPQSVTLYAEFLPTKHKGKCVVLMDCFWALGACFEVVLALVVYPYYGWRGLLALSATPLLIFTIL 226

  Fly   238 YIWLVPESPRWLFTTGKLDKSIKILEKIAKCNKAPTETIRPEIEAAYGALAARQPVKKGTVVDLF 302
            ..|| .||.|:....|..||:||:||:||..||.         ....|.|.|..   :.:..:.|
  Fly   227 SPWL-SESARYYSYNGHNDKAIKVLEQIAHNNKR---------HMLMGRLMADD---EPSCAESF 278

  Fly   303 R---TPYMRIKTIFMANNWLVVCMVYYG-------------------------TAQYVSALGGNI 339
            |   :|.:...||.:...||.....|||                         |:.::..|.  |
  Fly   279 RSLLSPSLYRTTILLWFLWLASAFCYYGLVLVTTELLVARNKESHPNECVTFMTSDFMDLLW--I 341

  Fly   340 FISNAIAAGVGIPGTCLCALMTKYLGRKKTLLLSNGCSALGLILLACLSTQAEAVRVTCATIGLF 404
            .:|.       .||..|...:.|..|:|||::|    ..|.|:|...:....|:...|..|:.:.
  Fly   342 TLSE-------FPGILLTIKVVKLFGKKKTIVL----QYLALVLCTLVLMSVESRFSTSVTLFIA 395

  Fly   405 GASIT--FPNVYLYGGELFPTVVRSSGVGLCSMVGRIGSIVAPLIVDLAAYGLWV-APLIFGIFS 466
            ..:|:  |..:|:|..|::|..:||.||..||::.|:|:::.|.:..:......: |...:.|..
  Fly   396 RGTISGIFQAIYVYTPEIYPAALRSVGVSGCSVLARLGAMLTPFVAQVLMDSSRIQAMSTYAIVG 460

  Fly   467 ILAMLGTIFLP-ETRG 481
            :||.:..:||| ||.|
  Fly   461 LLASIACVFLPRETVG 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8654NP_001246441.1 SP 85..487 CDD:273317 113/433 (26%)
MFS 87..477 CDD:119392 108/424 (25%)
CG4324NP_001286807.1 2A0119 10..476 CDD:273328 119/469 (25%)
MFS 60..471 CDD:119392 109/450 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24064
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1933
SonicParanoid 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.