DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8654 and Balat

DIOPT Version :10

Sequence 1:NP_611451.1 Gene:CG8654 / 37275 FlyBaseID:FBgn0034479 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_610823.1 Gene:Balat / 36417 FlyBaseID:FBgn0033778 Length:604 Species:Drosophila melanogaster


Alignment Length:121 Identity:25/121 - (20%)
Similarity:42/121 - (34%) Gaps:38/121 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   557 PVYRPKPTEMH---TIETNYVETPDTRPETLVHNQNG-----LIERTDLDRGHSPPQPDEYDRST 613
            |:..|.|...|   :|....:|||......|::...|     ::.::..::..|.|:|.....|.
  Fly   124 PIIVPHPETSHGGRSISPRIIETPGNHSPHLLYGSPGMNGFAMMLKSGGNQYTSSPEPPSDGASG 188

  Fly   614 GTRH-------------QPVDSDSED------DDMV--------GRYDKGIYQRPD 642
            ...|             :|..|.|:.      |:|:        .:.|.||   ||
  Fly   189 NVEHGATAGGSLVAIADKPARSPSDSGVSSILDEMLQPNLVLQRWKKDSGI---PD 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8654NP_611451.1 MFS_SLC22 82..477 CDD:340875
BalatNP_610823.1 MFS_SLC22 128..524 CDD:340875 24/117 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.