DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8654 and T05A1.5

DIOPT Version :9

Sequence 1:NP_001246441.1 Gene:CG8654 / 37275 FlyBaseID:FBgn0034479 Length:502 Species:Drosophila melanogaster
Sequence 2:NP_001366751.1 Gene:T05A1.5 / 188077 WormBaseID:WBGene00011456 Length:359 Species:Caenorhabditis elegans


Alignment Length:268 Identity:62/268 - (23%)
Similarity:119/268 - (44%) Gaps:29/268 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QDPKAPKPLKPVT--KTGDPIISQIGDFRRYQLFFFFIVLLCKFGTGWHTLGHIFLAAPTP-LSC 67
            |.|.....:|..|  |..| ::.|||.:..|.||..|            ::..::|.:..| :|.
 Worm    53 QSPNMTSSIKVETSIKVED-LLDQIGIWHPYPLFITF------------SMAFLWLLSVMPTMSP 104

  Fly    68 KTENVTDPCS-DECSETEFDTSVFQSTIITEWNLTCESKQLASLSQSIVMLGI-LFGSILFGMFA 130
            .....:.||: |.||..         |:..|:|:|........::.||..||. :.|.| :.:.|
 Worm   105 SYMAPSSPCTLDNCSFV---------TVQNEFNITKTLIDPGEMTSSIFFLGNGILGQI-YAVAA 159

  Fly   131 DRYGRRPAFLTCCFMQLITGLIVCVSPYYWFYCLFRFLVAVATAGTMTTSFVLLMEIVGPKKREM 195
            ||.||||..:...|:..::|:....:|.:....:.||............::|:..|.:.......
 Worm   160 DRIGRRPVLIASLFISGLSGIGAAYAPTFEIMLIGRFFQGSCFTALTMINWVMCCESISFSGHGY 224

  Fly   196 VAILYQIPFNIGHASLALFAYFIREWRWFQFSITIFSIVF-VIYIWLVPESPRWLFTTGKLDKSI 259
            .::|:.:.:.||:.|::..|.:...||:.|.:.::..::| ::.::.:|||..:|....|.|..:
 Worm   225 ASVLFGLCWVIGYCSVSPLAMYFSTWRYVQLATSVPCVLFGILMMFTLPESFSFLVAKRKRDDLV 289

  Fly   260 KILEKIAK 267
            |.:|..::
 Worm   290 KWIEMASR 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8654NP_001246441.1 SP 85..487 CDD:273317 41/185 (22%)
MFS 87..477 CDD:119392 41/183 (22%)
T05A1.5NP_001366751.1 MFS 117..>271 CDD:421695 35/163 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D386678at33208
OrthoFinder 1 1.000 - - FOG0000012
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.