DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8654 and slc22a5

DIOPT Version :9

Sequence 1:NP_001246441.1 Gene:CG8654 / 37275 FlyBaseID:FBgn0034479 Length:502 Species:Drosophila melanogaster
Sequence 2:XP_021324939.1 Gene:slc22a5 / 100000685 ZFINID:ZDB-GENE-091012-1 Length:549 Species:Danio rerio


Alignment Length:532 Identity:143/532 - (26%)
Similarity:239/532 - (44%) Gaps:86/532 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FFIVLLC-----KFGTGWHTLGHIFLAAPTPLSCKTE---------------------------- 70
            |||.|.|     ...||.|.|..:|:||.....|:.:                            
Zfish    17 FFIRLFCLLNLIYISTGLHGLYIVFVAASPAHRCRVDVNLTEDWLEASAPTETLSNGDLQVSQCW 81

  Fly    71 --------------------NVTDPCSDECSE-TEFDTSVFQSTIITEWNLTCESKQLASLSQSI 114
                                |:||...:.|.: ..:...|:.|||::||:|.|:|:....|:.|.
Zfish    82 RYSLQTLTNLSGQGYSPGQINITDIPRERCEDGWVYSADVYHSTIVSEWDLVCDSEWRVPLASST 146

  Fly   115 VMLGILFGSILFGMFADRYGRRPAFLTCCFMQLITGLIVCVSPYYWFYCLFRFLVAVATAGTMTT 179
            :.:|.|.|||:.|..:||:||:.........:.:.......||.:..:|:..|.:.........|
Zfish   147 LYMGYLLGSIVSGQLSDRFGRKKVLFGSLAAEALLMFAQSFSPSWLIFCVLYFFIGAFQISLYIT 211

  Fly   180 SFVLLMEIVGPKKREMVAILYQ-IPFNIGHASLALFAYFIREWRWFQFSITIFSIVFVIYIWLVP 243
            :|||..|::....|.:...|.. :.:.:|:..|...|:.||.||.....::..::|::...||:|
Zfish   212 AFVLGNEVLSGSLRVLFTTLGAFLHYCVGYMLLPWVAFAIRHWRTLLRVLSGLTVVYIPLWWLIP 276

  Fly   244 ESPRWLFTTGKLDKSIKILEKIAKCNKAPTETIRPEI--------EAAYGALAARQPVKKGTVVD 300
            ||||||.:.|.:.:|..||...|:.|:.|.    ||:        |||:       ...|.:.:|
Zfish   277 ESPRWLLSQGHVQESEAILRDAARKNRVPA----PEVIFKQSQIKEAAF-------QKSKYSALD 330

  Fly   301 LFRTPYMRIKTIFMANNWLVVCMVYYGTAQYVSALGGNIFISNAIAAGVGIPGTCLCALMTKYLG 365
            :.||..:|..|......|:.:.:.|:|.:...:.|.|:.|::..::|...:|...:...:.|...
Zfish   331 VLRTSNIRRTTFMCLLLWMAINIGYFGLSLNTTNLSGDPFLNCFLSAVTEVPAYIVSTFLLKSCP 395

  Fly   366 RKKT----LLLSNGCSALGLILLACLSTQAEAVRVTCATIGLFGASITFPNVYLYGGELFPTVVR 426
            |:..    |::..|.    |:|:..:..:.:.:.:.....|.||.:::|..||:|..||:|||:|
Zfish   396 RRPVLSAFLVIGGGF----LLLVQLIPDRLQTLALALEMAGKFGFTMSFTVVYIYTAELYPTVLR 456

  Fly   427 SSGVGLCSMVGRIGSIVAPLIVDLAAYGLWVAPLIFGIFSILAMLGTIFLPETRGTPLPETLED- 490
            :.|:|:||...|||||.||.|:.|..:...:..::.|..:|.|.|..:|||||.|..|||.||. 
Zfish   457 NLGMGMCSSAARIGSITAPYIIFLGTFNRHLPYVLMGSLTITASLANLFLPETFGKVLPENLEQM 521

  Fly   491 --GETF-GRKKK 499
              ..:| ||.|:
Zfish   522 QKSRSFPGRDKQ 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8654NP_001246441.1 SP 85..487 CDD:273317 119/414 (29%)
MFS 87..477 CDD:119392 112/402 (28%)
slc22a5XP_021324939.1 Sugar_tr 12..516 CDD:331684 135/513 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000012
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24064
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X24
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.