DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10822 and DYNLRB1

DIOPT Version :9

Sequence 1:NP_611450.1 Gene:CG10822 / 37274 FlyBaseID:FBgn0034478 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_001306086.1 Gene:DYNLRB1 / 83658 HGNCID:15468 Length:121 Species:Homo sapiens


Alignment Length:79 Identity:27/79 - (34%)
Similarity:52/79 - (65%) Gaps:0/79 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VEEVFRKVQEKPGVEDILIMNHSGVPVKTSMDRQEGLQYACLYDNLREKCQAFLSKMEPAQNLTL 79
            |||..:::|.:.||:.|:::|..|:|:|::||.....|||.|..:...|.::.:..::|..:||.
Human     4 VEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTF 68

  Fly    80 LRVRTKYHEVLITP 93
            ||:|:|.:|:::.|
Human    69 LRIRSKKNEIMVAP 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10822NP_611450.1 Robl_LC7 15..102 CDD:214939 27/79 (34%)
DYNLRB1NP_001306086.1 Robl_LC7 4..87 CDD:214939 27/79 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4115
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1512428at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.780

Return to query results.
Submit another query.