DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10822 and DYNLRB2

DIOPT Version :9

Sequence 1:NP_611450.1 Gene:CG10822 / 37274 FlyBaseID:FBgn0034478 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_001291946.1 Gene:DYNLRB2 / 83657 HGNCID:15467 Length:125 Species:Homo sapiens


Alignment Length:90 Identity:31/90 - (34%)
Similarity:59/90 - (65%) Gaps:0/90 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VEEVFRKVQEKPGVEDILIMNHSGVPVKTSMDRQEGLQYACLYDNLREKCQAFLSKMEPAQNLTL 79
            |||..:::|...||...:::|..|:|::|::|....:|||.|..:|..|.::.:..::|..:||.
Human    33 VEETLKRIQSHKGVIGTMVVNAEGIPIRTTLDNSTTVQYAGLLHHLTMKAKSTVRDIDPQNDLTF 97

  Fly    80 LRVRTKYHEVLITPDAKITVLVVQN 104
            ||:|:|.||:::.||.:..::|:||
Human    98 LRIRSKKHEIMVAPDKEYLLIVIQN 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10822NP_611450.1 Robl_LC7 15..102 CDD:214939 28/86 (33%)
DYNLRB2NP_001291946.1 Robl_LC7 34..122 CDD:308728 28/87 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4115
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2020
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1512428at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10779
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.