DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10822 and robls54B

DIOPT Version :9

Sequence 1:NP_611450.1 Gene:CG10822 / 37274 FlyBaseID:FBgn0034478 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_001097356.1 Gene:robls54B / 5740248 FlyBaseID:FBgn0263233 Length:112 Species:Drosophila melanogaster


Alignment Length:102 Identity:46/102 - (45%)
Similarity:72/102 - (70%) Gaps:0/102 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PKRTKSYVEEVFRKVQEKPGVEDILIMNHSGVPVKTSMDRQEGLQYACLYDNLREKCQAFLSKME 72
            |.||..|||:.|..|:.|..|.|::|:|.||.||.::|||::.:|::..:..:|.:.:..:||::
  Fly     9 PPRTLRYVEKAFDLVKSKKHVRDVVILNESGHPVMSTMDREDAVQFSGPFQAIRGRLERGMSKID 73

  Fly    73 PAQNLTLLRVRTKYHEVLITPDAKITVLVVQNAKDTF 109
            |...|.:||:||:.:|||:.||:|||:||||||.|.|
  Fly    74 PTDELLMLRIRTRTNEVLLVPDSKITLLVVQNAHDYF 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10822NP_611450.1 Robl_LC7 15..102 CDD:214939 35/86 (41%)
robls54BNP_001097356.1 Robl_LC7 16..103 CDD:214939 35/86 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464466
Domainoid 1 1.000 63 1.000 Domainoid score I17279
eggNOG 1 0.900 - - E1_KOG4115
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I7537
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1512428at2759
OrthoFinder 1 1.000 - - FOG0014411
OrthoInspector 1 1.000 - - mtm9612
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10779
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
98.900

Return to query results.
Submit another query.