DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10822 and dynlrb2

DIOPT Version :9

Sequence 1:NP_611450.1 Gene:CG10822 / 37274 FlyBaseID:FBgn0034478 Length:114 Species:Drosophila melanogaster
Sequence 2:XP_031755935.1 Gene:dynlrb2 / 549149 XenbaseID:XB-GENE-491537 Length:120 Species:Xenopus tropicalis


Alignment Length:96 Identity:32/96 - (33%)
Similarity:61/96 - (63%) Gaps:0/96 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 KSYVEEVFRKVQEKPGVEDILIMNHSGVPVKTSMDRQEGLQYACLYDNLREKCQAFLSKMEPAQN 76
            |:.|||..:::|...||...:::|..|:|::|::|....:|||.|...|..|.::.:..::|..:
 Frog    25 KAEVEETLKRIQSHKGVIGTIVVNAEGIPIRTTLDNSTTVQYAGLLHQLSMKAKSTVRDIDPQND 89

  Fly    77 LTLLRVRTKYHEVLITPDAKITVLVVQNAKD 107
            ||.||:|:|.||:::.||.:..::|:||..:
 Frog    90 LTFLRIRSKKHEIMVAPDKEYLLIVIQNPSE 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10822NP_611450.1 Robl_LC7 15..102 CDD:214939 28/86 (33%)
dynlrb2XP_031755935.1 Robl_LC7 27..117 CDD:397386 29/89 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1512428at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.