DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10822 and dynlrb1

DIOPT Version :9

Sequence 1:NP_611450.1 Gene:CG10822 / 37274 FlyBaseID:FBgn0034478 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_957482.1 Gene:dynlrb1 / 394163 ZFINID:ZDB-GENE-040426-989 Length:96 Species:Danio rerio


Alignment Length:90 Identity:33/90 - (36%)
Similarity:58/90 - (64%) Gaps:0/90 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VEEVFRKVQEKPGVEDILIMNHSGVPVKTSMDRQEGLQYACLYDNLREKCQAFLSKMEPAQNLTL 79
            |||..:::|.:.||:.|:|:|..|:|:|:::|....:|||.....|..|.:..:..::|..:||.
Zfish     4 VEETIKRIQSQKGVQGIIIVNAEGIPIKSTLDNTSTVQYAANIHQLLMKARGIVRDIDPQNDLTF 68

  Fly    80 LRVRTKYHEVLITPDAKITVLVVQN 104
            ||||:|.:|::|.||....::|:||
Zfish    69 LRVRSKKNEIMIAPDKDYFLIVIQN 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10822NP_611450.1 Robl_LC7 15..102 CDD:214939 30/86 (35%)
dynlrb1NP_957482.1 Robl_LC7 5..93 CDD:281277 30/87 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4115
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1512428at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
43.780

Return to query results.
Submit another query.