powered by:
Protein Alignment CG10822 and Dynlrb1
DIOPT Version :9
Sequence 1: | NP_611450.1 |
Gene: | CG10822 / 37274 |
FlyBaseID: | FBgn0034478 |
Length: | 114 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_038960100.1 |
Gene: | Dynlrb1 / 170714 |
RGDID: | 619910 |
Length: | 119 |
Species: | Rattus norvegicus |
Alignment Length: | 67 |
Identity: | 24/67 - (35%) |
Similarity: | 44/67 - (65%) |
Gaps: | 0/67 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 38 GVPVKTSMDRQEGLQYACLYDNLREKCQAFLSKMEPAQNLTLLRVRTKYHEVLITPDAKITVLVV 102
|:|:|::||.....|||.|..|...|.::.:.:::|..:||.||:|:|.:|:::.||....::|:
Rat 50 GIPIKSTMDNPTTTQYANLMHNFILKARSTVREIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVI 114
Fly 103 QN 104
||
Rat 115 QN 116
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4115 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1512428at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.820 |
|
Return to query results.
Submit another query.