DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10822 and dynlrb2

DIOPT Version :9

Sequence 1:NP_611450.1 Gene:CG10822 / 37274 FlyBaseID:FBgn0034478 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_001289961.1 Gene:dynlrb2 / 100001191 ZFINID:ZDB-GENE-120709-101 Length:96 Species:Danio rerio


Alignment Length:93 Identity:29/93 - (31%)
Similarity:58/93 - (62%) Gaps:0/93 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VEEVFRKVQEKPGVEDILIMNHSGVPVKTSMDRQEGLQYACLYDNLREKCQAFLSKMEPAQNLTL 79
            ||:..:::|.:.||...:::|..|:|::|::|....:|||.|...|..|.::.:..::|...||.
Zfish     4 VEDTLKRIQAQHGVIGTIVVNGEGIPIRTTLDNSTSVQYAGLLHQLTMKARSAVRDIDPQNELTF 68

  Fly    80 LRVRTKYHEVLITPDAKITVLVVQNAKD 107
            ||:|:|.||:::.||.:..::.:||..:
Zfish    69 LRIRSKKHEIMVAPDKEYLLIAIQNPSE 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10822NP_611450.1 Robl_LC7 15..102 CDD:214939 27/86 (31%)
dynlrb2NP_001289961.1 Robl_LC7 5..93 CDD:281277 26/87 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4115
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1512428at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10779
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.880

Return to query results.
Submit another query.