DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-7 and GHR1

DIOPT Version :9

Sequence 1:NP_523797.1 Gene:Toll-7 / 37272 FlyBaseID:FBgn0034476 Length:1446 Species:Drosophila melanogaster
Sequence 2:NP_001320016.1 Gene:GHR1 / 827842 AraportID:AT4G20940 Length:1037 Species:Arabidopsis thaliana


Alignment Length:585 Identity:154/585 - (26%)
Similarity:234/585 - (40%) Gaps:153/585 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 FEGLATLKSLRLSTHNSEWGPTRTLELFPDSLGGLKQLTDLDLGDNNL-RQLPSGFLCPVG---N 214
            |..|..|..|.:| :||..|      :.|:.||..|.|..|||.||.. ..||.    .:|   :
plant    74 FSNLTKLVKLSMS-NNSLSG------VLPNDLGSFKSLQFLDLSDNLFSSSLPK----EIGRSVS 127

  Fly   215 LQVLNLTRNRI--RTAEQMGFADMNCGAGSGSAGSELQVLDASHNELRS-ISESWGISRLRRLQH 276
            |:.|:|:.|..  ...|.||      |..|      ||.||.|.|.|.. :.:|  ::||..|.:
plant   128 LRNLSLSGNNFSGEIPESMG------GLIS------LQSLDMSSNSLSGPLPKS--LTRLNDLLY 178

  Fly   277 LNLAYNNLSELSGEALAGLASLRIVNLSNNHLETLPEGLFAGSKELREIHLQQNELYELPKGLFH 341
            |||:.|..:.........::||.:::|..|.::...:|         |..|..|..|        
plant   179 LNLSSNGFTGKMPRGFELISSLEVLDLHGNSIDGNLDG---------EFFLLTNASY-------- 226

  Fly   342 RLEQLLVVDLSGNQLTSNHVDNTTFAGLI-----RLIVLNLAHNALTRIDYRTFKELYFLQILNL 401
                   ||:|||:|.      ||...|:     .:..|||:||.|.......|:....|::|:|
plant   227 -------VDISGNRLV------TTSGKLLPGVSESIKHLNLSHNQLEGSLTSGFQLFQNLKVLDL 278

  Fly   402 RNNSIGHIEDNAFLPLYNLHTLNLAENRLH-TLDDKLFNG-LYVLSKLTLNNNLISVVEPAVFKN 464
            ..|.:.. |...|..:|:|..|.|:.||.. :|.:.|..| ..:|:.|.|:.|.:|....::.. 
plant   279 SYNMLSG-ELPGFNYVYDLEVLKLSNNRFSGSLPNNLLKGDSLLLTTLDLSGNNLSGPVSSIMS- 341

  Fly   465 CSDLKELDLSSNQL-NEVPRALQDLAMLRTLDLGENQIR-------TFDNQSFKNLHQ--LTG-- 517
             :.|..||||||.| .|:|.......:   |||..||..       .::|..:.:|.|  .||  
plant   342 -TTLHTLDLSSNSLTGELPLLTGGCVL---LDLSNNQFEGNLTRWSKWENIEYLDLSQNHFTGSF 402

  Fly   518 ------------LRLIDNQI-GNITVGMFQDLPRLSVLNLAKNRIQSIERGSFDKNFELEAIRLD 569
                        |.|..|:: |::...:....|:|.||:::.|.::....|:......||.|.|.
plant   403 PDATPQLLRANHLNLSYNKLTGSLPERIPTHYPKLRVLDISSNSLEGPIPGALLSMPTLEEIHLQ 467

  Fly   570 RN-------------------------FLADINGVFATLVSLLWLNLSENHLVWFDYAFIPSNLK 609
            .|                         |..|:.|||.:|.:|..|||:.|:|    ...:||::.
plant   468 NNGMTGNIGPLPSSGSRIRLLDLSHNRFDGDLPGVFGSLTNLQVLNLAANNL----SGSLPSSMN 528

  Fly   610 WLDIHGNYIEALGNYYKLQEEIRVKTLDASHNRITEIGPMSIPNTIELLFIN---NNLIGNVQPN 671
              ||                 :.:.:||.|.|..|  ||:....:..::..|   |:|.|.|..|
plant   529 --DI-----------------VSLSSLDVSQNHFT--GPLPSNLSSNIMAFNVSYNDLSGTVPEN 572

  Fly   672  671
            plant   573  572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-7NP_523797.1 LRR_8 135..201 CDD:290566 18/46 (39%)
leucine-rich repeat 136..159 CDD:275380 2/4 (50%)
leucine-rich repeat 160..190 CDD:275380 9/29 (31%)
LRR_8 189..259 CDD:290566 25/75 (33%)
leucine-rich repeat 191..214 CDD:275380 9/26 (35%)
leucine-rich repeat 215..248 CDD:275380 9/34 (26%)
LRR_RI 247..501 CDD:238064 74/262 (28%)
LRR_8 247..308 CDD:290566 19/61 (31%)
leucine-rich repeat 249..273 CDD:275380 10/24 (42%)
leucine-rich repeat 274..297 CDD:275380 5/22 (23%)
LRR_8 297..356 CDD:290566 14/58 (24%)
leucine-rich repeat 298..321 CDD:275380 4/22 (18%)
leucine-rich repeat 322..345 CDD:275380 4/22 (18%)
LRR_8 345..406 CDD:290566 20/65 (31%)
leucine-rich repeat 346..371 CDD:275380 9/29 (31%)
leucine-rich repeat 372..395 CDD:275380 7/22 (32%)
leucine-rich repeat 396..419 CDD:275380 6/22 (27%)
LRR_8 419..478 CDD:290566 20/60 (33%)
leucine-rich repeat 420..443 CDD:275380 8/24 (33%)
leucine-rich repeat 444..467 CDD:275380 5/22 (23%)
LRR_RI 466..622 CDD:238064 51/205 (25%)
leucine-rich repeat 468..488 CDD:275380 10/20 (50%)
LRR_8 491..549 CDD:290566 19/81 (23%)
leucine-rich repeat 491..514 CDD:275380 7/29 (24%)
leucine-rich repeat 515..536 CDD:275380 6/35 (17%)
leucine-rich repeat 539..562 CDD:275380 5/22 (23%)
leucine-rich repeat 563..585 CDD:275380 11/46 (24%)
leucine-rich repeat 586..626 CDD:275380 10/39 (26%)
leucine-rich repeat 627..653 CDD:275380 7/25 (28%)
LRRCT 716..772 CDD:214507
LRRNT 796..830 CDD:214470
leucine-rich repeat 812..829 CDD:275380
leucine-rich repeat 833..854 CDD:275380
LRR_8 853..913 CDD:290566
leucine-rich repeat 855..878 CDD:275380
LRR_4 878..918 CDD:289563
leucine-rich repeat 879..902 CDD:275380
leucine-rich repeat 903..926 CDD:275380
leucine-rich repeat 927..953 CDD:275380
TIR 1098..1235 CDD:214587
GHR1NP_001320016.1 PLN00113 2..1036 CDD:215061 154/585 (26%)
leucine-rich repeat 80..103 CDD:275380 9/29 (31%)
leucine-rich repeat 104..127 CDD:275380 9/26 (35%)
leucine-rich repeat 128..151 CDD:275380 8/28 (29%)
leucine-rich repeat 152..175 CDD:275380 10/24 (42%)
leucine-rich repeat 176..199 CDD:275380 5/22 (23%)
leucine-rich repeat 200..223 CDD:275380 6/31 (19%)
leucine-rich repeat 224..248 CDD:275380 10/44 (23%)
leucine-rich repeat 249..272 CDD:275380 7/22 (32%)
leucine-rich repeat 296..314 CDD:275380 6/17 (35%)
leucine-rich repeat 344..387 CDD:275380 15/45 (33%)
leucine-rich repeat 388..412 CDD:275380 4/23 (17%)
leucine-rich repeat 413..436 CDD:275380 4/22 (18%)
leucine-rich repeat 437..460 CDD:275380 5/22 (23%)
leucine-rich repeat 461..484 CDD:275380 5/22 (23%)
leucine-rich repeat 485..508 CDD:275380 6/22 (27%)
leucine-rich repeat 509..532 CDD:275380 10/45 (22%)
leucine-rich repeat 533..553 CDD:275380 7/21 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.