DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-7 and Lrrc15

DIOPT Version :9

Sequence 1:NP_523797.1 Gene:Toll-7 / 37272 FlyBaseID:FBgn0034476 Length:1446 Species:Drosophila melanogaster
Sequence 2:NP_083249.1 Gene:Lrrc15 / 74488 MGIID:1921738 Length:579 Species:Mus musculus


Alignment Length:432 Identity:133/432 - (30%)
Similarity:197/432 - (45%) Gaps:30/432 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 LQVLDASHNELRSISESWGISRLRRLQHLNLAYNNLSELSGEALAGLASLRIVNLSNNHLETLPE 313
            ||:|:....||.. .:...||.|..|:   :..|.|:.:...|...|.|||.::|:||.|:.||.
Mouse    58 LQILNTHITELPE-DKFLNISALIALK---MEKNELANIMPGAFRNLGSLRHLSLANNKLKNLPV 118

  Fly   314 GLFAGSKELREIHLQQNELYELPKGLFHRLEQLLVVDLSGNQLTSNHVDNTTFAGLIRLIVLNLA 378
            .||.....|..:.|..|:|.::....|.:...|..:.|.||.|  .::....|..|:.|..|||.
Mouse   119 RLFQDVNNLETLLLSNNQLVQIQPAQFSQFSNLKELQLYGNNL--EYIPEGVFDHLVGLTKLNLG 181

  Fly   379 HNALTRIDYRTFKELYFLQILNLRNNSIGHIEDNAFLPLYNLHTLNLAENRLHTLDDKLFNGLYV 443
            :|..|.:..|.|:.|..||:|.|..|.:..|....|..|.||..|.|.||::.||...||:....
Mouse   182 NNGFTHLSPRVFQHLGNLQVLRLYENRLSDIPMGTFDALGNLQELALQENQIGTLSPGLFHNNRN 246

  Fly   444 LSKLTLNNNLISVVEPAVFKNCSDLKELDLSSNQLNEV-PRALQDLAMLRTLDLGENQIRTFDNQ 507
            |.:|.|:||.||.:.|.:|.....|.:|.|..|.|.|: |.....:..||.|.|..|.|.:..:.
Mouse   247 LQRLYLSNNHISHLPPGIFMQLPHLNKLTLFGNSLKELSPGVFGPMPNLRELWLYNNHITSLPDN 311

  Fly   508 SFKNLHQLTGLRLIDNQIGNITVGMFQDLPRLSVLNLAKNRIQSIERGSFDKNFELEAIRLDRNF 572
            :|.:|:||..|.|..||:..|:.|.|..|..|..|:|..|.:|.::...|.....|..:.|..|.
Mouse   312 AFSHLNQLQVLILSHNQLSYISPGAFNGLTNLRELSLHTNALQDLDGNVFRSLANLRNVSLQNNR 376

  Fly   573 LADING-VFATLVSLLWLNLSENHLV-----WFDYAFIPSNLKWLDIHGNYIEALGNYYKLQEEI 631
            |..:.| :||.:..|:.:.|..|:|.     .||:.   .||..|.::.|......|...|.:.:
Mouse   377 LRQLPGSIFANVNGLMTIQLQNNNLENLPLGIFDHL
---GNLCELRLYDNPWRCDSNILPLHDWL 438

  Fly   632 RVKTLDASHNRI---TEIGPM-SIPNTI---ELLFINNNLIG 666
            .:       ||.   |:..|: |.|.::   .|:.||.|..|
Mouse   439 IL-------NRARLGTDTLPVCSSPASVRGQSLVIINVNFPG 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-7NP_523797.1 LRR_8 135..201 CDD:290566
leucine-rich repeat 136..159 CDD:275380
leucine-rich repeat 160..190 CDD:275380
LRR_8 189..259 CDD:290566 3/9 (33%)
leucine-rich repeat 191..214 CDD:275380
leucine-rich repeat 215..248 CDD:275380
LRR_RI 247..501 CDD:238064 84/252 (33%)
LRR_8 247..308 CDD:290566 19/58 (33%)
leucine-rich repeat 249..273 CDD:275380 8/23 (35%)
leucine-rich repeat 274..297 CDD:275380 5/22 (23%)
LRR_8 297..356 CDD:290566 20/58 (34%)
leucine-rich repeat 298..321 CDD:275380 10/22 (45%)
leucine-rich repeat 322..345 CDD:275380 5/22 (23%)
LRR_8 345..406 CDD:290566 21/60 (35%)
leucine-rich repeat 346..371 CDD:275380 7/24 (29%)
leucine-rich repeat 372..395 CDD:275380 9/22 (41%)
leucine-rich repeat 396..419 CDD:275380 8/22 (36%)
LRR_8 419..478 CDD:290566 23/58 (40%)
leucine-rich repeat 420..443 CDD:275380 9/22 (41%)
leucine-rich repeat 444..467 CDD:275380 9/22 (41%)
LRR_RI 466..622 CDD:238064 48/162 (30%)
leucine-rich repeat 468..488 CDD:275380 7/20 (35%)
LRR_8 491..549 CDD:290566 22/57 (39%)
leucine-rich repeat 491..514 CDD:275380 8/22 (36%)
leucine-rich repeat 515..536 CDD:275380 8/20 (40%)
leucine-rich repeat 539..562 CDD:275380 6/22 (27%)
leucine-rich repeat 563..585 CDD:275380 7/22 (32%)
leucine-rich repeat 586..626 CDD:275380 11/44 (25%)
leucine-rich repeat 627..653 CDD:275380 6/29 (21%)
LRRCT 716..772 CDD:214507
LRRNT 796..830 CDD:214470
leucine-rich repeat 812..829 CDD:275380
leucine-rich repeat 833..854 CDD:275380
LRR_8 853..913 CDD:290566
leucine-rich repeat 855..878 CDD:275380
LRR_4 878..918 CDD:289563
leucine-rich repeat 879..902 CDD:275380
leucine-rich repeat 903..926 CDD:275380
leucine-rich repeat 927..953 CDD:275380
TIR 1098..1235 CDD:214587
Lrrc15NP_083249.1 LRR 1 54..75 5/17 (29%)
leucine-rich repeat 58..78 CDD:275380 6/20 (30%)
LRR 2 78..99 5/23 (22%)
PLN00113 82..>401 CDD:215061 105/323 (33%)
LRR 3 102..123 11/20 (55%)
leucine-rich repeat 103..126 CDD:275380 10/22 (45%)
LRR 4 126..147 5/20 (25%)
leucine-rich repeat 127..150 CDD:275380 5/22 (23%)
LRR 5 150..171 6/22 (27%)
leucine-rich repeat 151..174 CDD:275380 7/24 (29%)
LRR 6 174..195 8/20 (40%)
leucine-rich repeat 175..198 CDD:275380 9/22 (41%)
LRR 7 198..219 7/20 (35%)
leucine-rich repeat 199..222 CDD:275380 8/22 (36%)
LRR 8 222..243 10/20 (50%)
leucine-rich repeat 223..246 CDD:275380 9/22 (41%)
LRR 9 246..267 9/20 (45%)
leucine-rich repeat 247..270 CDD:275380 9/22 (41%)
LRR 10 270..291 7/20 (35%)
leucine-rich repeat 271..294 CDD:275380 7/22 (32%)
LRR 11 294..315 7/20 (35%)
leucine-rich repeat 295..318 CDD:275380 8/22 (36%)
LRR 12 318..339 9/20 (45%)
leucine-rich repeat 319..342 CDD:275380 9/22 (41%)
LRR 13 342..363 6/20 (30%)
leucine-rich repeat 343..364 CDD:275380 6/20 (30%)
LRR 14 366..387 6/20 (30%)
leucine-rich repeat 367..387 CDD:275380 6/19 (32%)
LRR 15 390..411 5/20 (25%)
leucine-rich repeat 391..412 CDD:275380 6/20 (30%)
LRRCT 423..>462 CDD:214507 9/45 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 476..509
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.