DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-7 and Cpn2

DIOPT Version :9

Sequence 1:NP_523797.1 Gene:Toll-7 / 37272 FlyBaseID:FBgn0034476 Length:1446 Species:Drosophila melanogaster
Sequence 2:NP_082180.2 Gene:Cpn2 / 71756 MGIID:1919006 Length:547 Species:Mus musculus


Alignment Length:446 Identity:125/446 - (28%)
Similarity:191/446 - (42%) Gaps:98/446 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 AFEGLATL-KSLRLSTHNSEWGPTRTLELFPDSLGGLKQLTDLDLGDNNLRQLPSGFLCPVGNLQ 216
            ||.|...| |.:.|:|.      .|.||  ||:.|||.:|.||::..:           ||.|| 
Mouse    68 AFSGSPNLTKVVFLNTQ------VRHLE--PDAFGGLPRLQDLEITGS-----------PVSNL- 112

  Fly   217 VLNLTRNRIRTAEQMGFADMNCGAGSGSAGSELQVLDASHNELRSISESWGISRLRRLQHLNLAY 281
                                                 ::|.          .|.|..|:.|.|.:
Mouse   113 -------------------------------------SAHI----------FSNLSSLEKLTLDF 130

  Fly   282 NNLSELSGEALAGLASLRIVNLSNNHLETLPEGLFAGSKELREIHLQQNELYELPKGLFHRLEQL 346
            :.|:.|..:....:..|..:.|..|.|.|||..||...::||.::|.||.|.:||||.|..|..|
Mouse   131 DRLAGLPEDLFCHMDILESLQLQGNQLRTLPGRLFQSLRDLRTLNLAQNLLTQLPKGAFQSLTGL 195

  Fly   347 LVVDLSGNQLTSNHVDNTTFAGLIRLIVLNLAHNALTRIDYRTFKELYFLQILNLRNNSIGHIED 411
            .::.||.|.|.  .:.......|..|..|.|..||:|.:....|.:|:.|::|.|::|:|.|:..
Mouse   196 QMLKLSNNMLA--RLPEGALGSLSSLQELFLDGNAITELSPHLFSQLFSLEMLWLQHNAICHLPV 258

  Fly   412 NAFLPLYNLHTLNLAENRLHTLDDKLFNGLYVLSKLTLNNNLISVVEPAVFKNCSDLKELDLSSN 476
            :.|..|:||..|:|.:|.|.||.:.||.....|..|:|:.|.:..:....|.|.|.|..|.||.|
Mouse   259 SLFSSLHNLTFLSLKDNALRTLPEGLFAHNQGLLHLSLSYNQLETIPEGAFTNLSRLVSLTLSHN 323

  Fly   477 QLNEVPRALQDLAMLRTLDLGENQIRTFDNQSFKNLHQLTGLRLIDNQIGNITVGMFQDLPRLSV 541
            .:.::|..:                       |:||.||..|.|..|.:..:...:|.:|.||.:
Mouse   324 AITDLPEHV-----------------------FRNLEQLVKLSLDSNNLTALHPALFHNLSRLQL 365

  Fly   542 LNLAKNRIQSIERGSFDKNFELEAIRLDRN-FLADINGVFATLVSLLWLNLSENHL 596
            |||::|::.::..|.||.|::|..:.|..| :..|.:..:.|    .||.|..|.:
Mouse   366 LNLSRNQLTTLPGGIFDTNYDLFNLALLGNPWQCDCHLSYLT----SWLRLYNNQI 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-7NP_523797.1 LRR_8 135..201 CDD:290566 18/48 (38%)
leucine-rich repeat 136..159 CDD:275380 3/5 (60%)
leucine-rich repeat 160..190 CDD:275380 12/30 (40%)
LRR_8 189..259 CDD:290566 8/69 (12%)
leucine-rich repeat 191..214 CDD:275380 5/22 (23%)
leucine-rich repeat 215..248 CDD:275380 1/32 (3%)
LRR_RI 247..501 CDD:238064 74/253 (29%)
LRR_8 247..308 CDD:290566 11/60 (18%)
leucine-rich repeat 249..273 CDD:275380 3/23 (13%)
leucine-rich repeat 274..297 CDD:275380 5/22 (23%)
LRR_8 297..356 CDD:290566 25/58 (43%)
leucine-rich repeat 298..321 CDD:275380 9/22 (41%)
leucine-rich repeat 322..345 CDD:275380 12/22 (55%)
LRR_8 345..406 CDD:290566 18/60 (30%)
leucine-rich repeat 346..371 CDD:275380 6/24 (25%)
leucine-rich repeat 372..395 CDD:275380 8/22 (36%)
leucine-rich repeat 396..419 CDD:275380 8/22 (36%)
LRR_8 419..478 CDD:290566 22/58 (38%)
leucine-rich repeat 420..443 CDD:275380 9/22 (41%)
leucine-rich repeat 444..467 CDD:275380 6/22 (27%)
LRR_RI 466..622 CDD:238064 36/132 (27%)
leucine-rich repeat 468..488 CDD:275380 6/19 (32%)
LRR_8 491..549 CDD:290566 16/57 (28%)
leucine-rich repeat 491..514 CDD:275380 3/22 (14%)
leucine-rich repeat 515..536 CDD:275380 5/20 (25%)
leucine-rich repeat 539..562 CDD:275380 9/22 (41%)
leucine-rich repeat 563..585 CDD:275380 5/22 (23%)
leucine-rich repeat 586..626 CDD:275380 4/11 (36%)
leucine-rich repeat 627..653 CDD:275380
LRRCT 716..772 CDD:214507
LRRNT 796..830 CDD:214470
leucine-rich repeat 812..829 CDD:275380
leucine-rich repeat 833..854 CDD:275380
LRR_8 853..913 CDD:290566
leucine-rich repeat 855..878 CDD:275380
LRR_4 878..918 CDD:289563
leucine-rich repeat 879..902 CDD:275380
leucine-rich repeat 903..926 CDD:275380
leucine-rich repeat 927..953 CDD:275380
TIR 1098..1235 CDD:214587
Cpn2NP_082180.2 LRRNT 21..52 CDD:214470
LRR_8 73..133 CDD:290566 25/126 (20%)
leucine-rich repeat 75..98 CDD:275380 12/30 (40%)
LRR 1 98..119 8/79 (10%)
leucine-rich repeat 99..122 CDD:275380 10/81 (12%)
LRR_8 121..181 CDD:290566 19/59 (32%)
LRR 2 122..143 5/20 (25%)
leucine-rich repeat 123..146 CDD:275380 5/22 (23%)
LRR 3 146..167 9/20 (45%)
leucine-rich repeat 147..170 CDD:275380 9/22 (41%)
LRR_RI 149..374 CDD:238064 81/249 (33%)
LRR 4 170..191 11/20 (55%)
LRR_8 171..229 CDD:290566 22/59 (37%)
leucine-rich repeat 171..194 CDD:275380 12/22 (55%)
LRR 5 194..215 5/22 (23%)
leucine-rich repeat 195..218 CDD:275380 6/24 (25%)
LRR_8 217..277 CDD:290566 21/59 (36%)
LRR 6 218..239 7/20 (35%)
leucine-rich repeat 219..242 CDD:275380 8/22 (36%)
LRR 7 242..263 7/20 (35%)
leucine-rich repeat 243..266 CDD:275380 8/22 (36%)
LRR_8 266..325 CDD:290566 22/58 (38%)
LRR 8 266..287 10/20 (50%)
leucine-rich repeat 267..290 CDD:275380 9/22 (41%)
LRR 9 290..311 5/20 (25%)
leucine-rich repeat 291..314 CDD:275380 6/22 (27%)
LRR_8 313..373 CDD:290566 23/82 (28%)
LRR 10 314..335 7/43 (16%)
leucine-rich repeat 315..338 CDD:275380 9/45 (20%)
LRR 11 338..359 6/20 (30%)
leucine-rich repeat 339..360 CDD:275380 5/20 (25%)
LRR 12 362..383 8/20 (40%)
leucine-rich repeat 363..382 CDD:275380 6/18 (33%)
LRRCT 395..436 CDD:214507 7/27 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X221
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.