DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-7 and Lrrtm2

DIOPT Version :9

Sequence 1:NP_523797.1 Gene:Toll-7 / 37272 FlyBaseID:FBgn0034476 Length:1446 Species:Drosophila melanogaster
Sequence 2:NP_001102939.1 Gene:Lrrtm2 / 685472 RGDID:1593785 Length:515 Species:Rattus norvegicus


Alignment Length:354 Identity:96/354 - (27%)
Similarity:153/354 - (43%) Gaps:45/354 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 FHRLEQLLVVDLSGNQLTSNHV---DNTTFAGLIRLIVLNLAHNALTRIDYRTFKELYFLQILNL 401
            ||.:.........|..|..||:   :...||...:|..|:|.||.::.:....|:.||.|:.|.|
  Rat    52 FHSVPNATDKGSLGLSLRHNHITALERDQFASFSQLTWLHLDHNQISTVKEDAFQGLYKLKELIL 116

  Fly   402 RNNSIGHIEDNAFLPLYNLHTLNLAENRLHTLDDKLFNGLYVLSKLTLNNNLISVVEPAVFKNCS 466
            .:|.|.::.:..|..|.||..|:|:.|:|.:|..:||.||..|..|.|.:|.:..:...:|.:|.
  Rat   117 SSNKIFYLPNTTFTQLINLQNLDLSFNQLSSLHPELFYGLRKLQTLHLRSNSLRTIPVRLFWDCR 181

  Fly   467 DLKELDLSSNQLNEVPR-ALQDLAMLRTLDLGENQIRTFDNQSFKNLHQLTGLRLIDNQIGNITV 530
            .|:.||||:|:|..:.| ....|..||.|.|..||:...:...|..|..|..|.|..|:|.|:|.
  Rat   182 SLEFLDLSTNRLRSLARNGFAGLIKLRELHLEHNQLTKINFAHFLRLSSLHTLFLQWNKISNLTC 246

  Fly   531 GMFQDLPRLSVLNLAKNRIQSIERGSFDKNFELEAIRLDRNFLADING-VFATLVSLLWLNLSEN 594
            ||......|..|:|..|.|::|:...|:....|:.:.:|.|.|..::. :.::|.||..:.||.|
  Rat   247 GMEWTWSTLEKLDLTGNEIKAIDLTVFETMPNLKILLMDNNKLNSLDSKILSSLRSLTTVGLSGN 311

  Fly   595 HLVWFDYAFIPSNLKWLD--------------------------IHG--------NYIEALGNYY 625
              :|.....:.:...||.                          :||        ..:.|:...|
  Rat   312 --LWECSPRVCALASWLGSFQGRWEHSILCHSPDHTQGEDILDAVHGFQLCWNLSTTVTAMATTY 374

  Fly   626 KLQEEIRVKTLDASHNRITEIGPMSIPNT 654
            :.......|...:|::    :|...||.|
  Rat   375 RDPTTEYTKISSSSYH----VGDKEIPTT 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-7NP_523797.1 LRR_8 135..201 CDD:290566
leucine-rich repeat 136..159 CDD:275380
leucine-rich repeat 160..190 CDD:275380
LRR_8 189..259 CDD:290566
leucine-rich repeat 191..214 CDD:275380
leucine-rich repeat 215..248 CDD:275380
LRR_RI 247..501 CDD:238064 54/164 (33%)
LRR_8 247..308 CDD:290566
leucine-rich repeat 249..273 CDD:275380
leucine-rich repeat 274..297 CDD:275380
LRR_8 297..356 CDD:290566 3/15 (20%)
leucine-rich repeat 298..321 CDD:275380
leucine-rich repeat 322..345 CDD:275380 2/4 (50%)
LRR_8 345..406 CDD:290566 18/63 (29%)
leucine-rich repeat 346..371 CDD:275380 6/27 (22%)
leucine-rich repeat 372..395 CDD:275380 7/22 (32%)
leucine-rich repeat 396..419 CDD:275380 7/22 (32%)
LRR_8 419..478 CDD:290566 23/58 (40%)
leucine-rich repeat 420..443 CDD:275380 10/22 (45%)
leucine-rich repeat 444..467 CDD:275380 6/22 (27%)
LRR_RI 466..622 CDD:238064 49/191 (26%)
leucine-rich repeat 468..488 CDD:275380 8/20 (40%)
LRR_8 491..549 CDD:290566 21/57 (37%)
leucine-rich repeat 491..514 CDD:275380 8/22 (36%)
leucine-rich repeat 515..536 CDD:275380 9/20 (45%)
leucine-rich repeat 539..562 CDD:275380 7/22 (32%)
leucine-rich repeat 563..585 CDD:275380 5/22 (23%)
leucine-rich repeat 586..626 CDD:275380 10/73 (14%)
leucine-rich repeat 627..653 CDD:275380 4/25 (16%)
LRRCT 716..772 CDD:214507
LRRNT 796..830 CDD:214470
leucine-rich repeat 812..829 CDD:275380
leucine-rich repeat 833..854 CDD:275380
LRR_8 853..913 CDD:290566
leucine-rich repeat 855..878 CDD:275380
LRR_4 878..918 CDD:289563
leucine-rich repeat 879..902 CDD:275380
leucine-rich repeat 903..926 CDD:275380
leucine-rich repeat 927..953 CDD:275380
TIR 1098..1235 CDD:214587
Lrrtm2NP_001102939.1 LRR 1 61..83 5/21 (24%)
leucine-rich repeat 66..86 CDD:275380 5/19 (26%)
LRR_RI 73..311 CDD:238064 76/237 (32%)
LRR 2 84..107 6/22 (27%)
LRR_8 85..145 CDD:290566 20/59 (34%)
leucine-rich repeat 87..110 CDD:275380 7/22 (32%)
LRR 3 109..131 7/21 (33%)
leucine-rich repeat 111..134 CDD:275380 7/22 (32%)
LRR 4 132..155 10/22 (45%)
LRR_8 134..193 CDD:290566 23/58 (40%)
leucine-rich repeat 135..158 CDD:275380 10/22 (45%)
LRR 5 156..179 6/22 (27%)
leucine-rich repeat 159..182 CDD:275380 6/22 (27%)
LRR_8 181..241 CDD:290566 21/59 (36%)
LRR 6 181..203 8/21 (38%)
leucine-rich repeat 183..206 CDD:275380 9/22 (41%)
LRR 7 205..227 7/21 (33%)
leucine-rich repeat 207..230 CDD:275380 8/22 (36%)
LRR 8 229..251 9/21 (43%)
leucine-rich repeat 231..254 CDD:275380 9/22 (41%)
LRR 9 252..275 7/22 (32%)
LRR_8 253..312 CDD:290566 17/60 (28%)
leucine-rich repeat 255..278 CDD:275380 7/22 (32%)
LRR 10 276..299 4/22 (18%)
leucine-rich repeat 279..300 CDD:275380 4/20 (20%)
Involved in DLG4-binding 512..515
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.