DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-7 and Vasn

DIOPT Version :9

Sequence 1:NP_523797.1 Gene:Toll-7 / 37272 FlyBaseID:FBgn0034476 Length:1446 Species:Drosophila melanogaster
Sequence 2:NP_001102852.1 Gene:Vasn / 679921 RGDID:1598149 Length:673 Species:Rattus norvegicus


Alignment Length:779 Identity:166/779 - (21%)
Similarity:261/779 - (33%) Gaps:282/779 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   375 LNLAHNALTRIDYRTFKELYFLQILNLRNNSIGHIEDNAFLPLYNLHTLNLAENRLHTLDDKLFN 439
            |.:..|.:|.:|...|.....||:|:|..|.|..:....|.||.||..|:|..|:||.:.::.|.
  Rat    58 LYIFENGITTLDVGCFAGFPGLQLLDLSQNQITSLPGGIFQPLVNLSNLDLTANKLHEISNETFR 122

  Fly   440 GLYVLSKLTLNNNLISVVEPAVFKNCSDLKELDLSSNQLNEVPRALQDLAMLRTLDLGENQIRTF 504
            ||..|.:|.|..|.|..::|..|.....|.||.|..|:|..:|                      
  Rat   123 GLRRLERLYLGKNRIRHIQPGAFDALDHLLELKLPDNELRVLP---------------------- 165

  Fly   505 DNQSFKNLHQLTGLRLIDNQIGNITVGMFQDLPRLSVLNLAKNRIQSIERGSFDKNFELEAIRLD 569
                  .||                      ||||.:|:|:.|.|.::|.|..| ...:||:||.
  Rat   166 ------PLH----------------------LPRLLLLDLSHNSIPALEAGILD-TANVEALRLA 201

  Fly   570 RNFLADIN-GVFATLVSLLWLNLSENHLVWFDYAFIPSNLKWLDIHGNYIEALGNYYKLQEEIRV 633
            ...|..:: |:|..|.:|..|::|:|.|     ..:||          .|:.|....:|:     
  Rat   202 GLGLRQLDEGLFGRLRNLHDLDVSDNQL-----GHMPS----------VIQGLRGLTRLR----- 246

  Fly   634 KTLDASHNRITEIGPMSIPNTIELLFINNNLIGNVQPNAFVDKANLARVDLYANQLSKLQLQQLR 698
                                     ...|..|..::|........|..:|     :|.|.||.| 
  Rat   247 -------------------------LAGNTRIAQIRPEDLAGLTALQELD-----VSNLSLQAL- 280

  Fly   699 VAPVVAPKPLPEFY-------LGGNPFECDCTMDWLQRINNLTTRQHPRVMDMANIECVMPHARG 756
                  |..|...:       ...|||.|.|.:.|..                       |..|.
  Rat   281 ------PSDLSSLFPRLRLLAAARNPFNCLCPLSWFG-----------------------PWVRE 316

  Fly   757 AAVRPLSGLRPQDFLCRY-ESHCFALCHCCDFDACDCEMTC--------------PSNCTCYHDQ 806
            :.|...|   |::..|.: ..:...|....|:....|.:|.              |:..|.....
  Rat   317 SHVVLAS---PEETRCHFPPKNAGRLLLELDYADFGCPVTTTTATVPTIRPTVREPTPSTSSQAP 378

  Fly   807 IWSTNVVDCGGQQTTELP----------RRVPMDS---SVVYLDGNNFPV-LKNH-------AFI 850
            .|.:..     :.||:.|          |..|...   :.:.|:|.:..| .|:|       .||
  Rat   379 TWPSPT-----EPTTQAPIVLSTAPPTMRPAPQPQDCPASICLNGGSCRVGAKHHLECLCPEGFI 438

  Fly   851 GRKNLRALYVNGSQVAAIQNRTFAS----------LASLQLLHLADNKLRTLHGYEFEQLSALRE 905
            |      ||..    :.::.||..|          |..|::..::...||.    |.::      
  Rat   439 G------LYCE----SPVEQRTKPSSIPDTPRPPRLLPLRIEPVSPTSLRV----ELQR------ 483

  Fly   906 LYLQNNQLTTIENATLAPLAALELI--RIDG--NRLVTLPIWQMHATHFGTRLK----------S 956
             |||.|   |::      |.:|.|.  .:.|  .|||||.:....|.:..|:|:          :
  Rat   484 -YLQGN---TVQ------LRSLRLTYRNLSGPDKRLVTLRLPASLAEYTVTQLRPNATYSICVTA 538

  Fly   957 ISLGR---NQWSC-RCQFLQALTSYVADNALIVQDAQD-----------------------IYCM 994
            :..||   .:.:| .....||:.|   ::|.:.|..:.                       :||:
  Rat   539 LGAGRTPEGEEACGEANTPQAVRS---NHAPVTQAREGNLPLLIAPALAAVLLAVLAASGAVYCV 600

  Fly   995 AASSGTGSAALEDSSS---NSGSLE----KRELDFNATGAACTDYYSGGSMLQHGIPESYIPLL 1051
            ..:..:.:|  :|...   .:|.||    |..|:   .|:..::  .||..|..| ||..:||:
  Rat   601 RRARASSTA--QDKGQVGPGTGPLELEGVKVPLE---PGSKASE--GGGEALSGG-PECEVPLM 656

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-7NP_523797.1 LRR_8 135..201 CDD:290566
leucine-rich repeat 136..159 CDD:275380
leucine-rich repeat 160..190 CDD:275380
LRR_8 189..259 CDD:290566
leucine-rich repeat 191..214 CDD:275380
leucine-rich repeat 215..248 CDD:275380
LRR_RI 247..501 CDD:238064 38/125 (30%)
LRR_8 247..308 CDD:290566
leucine-rich repeat 249..273 CDD:275380
leucine-rich repeat 274..297 CDD:275380
LRR_8 297..356 CDD:290566
leucine-rich repeat 298..321 CDD:275380
leucine-rich repeat 322..345 CDD:275380
LRR_8 345..406 CDD:290566 10/30 (33%)
leucine-rich repeat 346..371 CDD:275380
leucine-rich repeat 372..395 CDD:275380 5/19 (26%)
leucine-rich repeat 396..419 CDD:275380 9/22 (41%)
LRR_8 419..478 CDD:290566 22/58 (38%)
leucine-rich repeat 420..443 CDD:275380 9/22 (41%)
leucine-rich repeat 444..467 CDD:275380 7/22 (32%)
LRR_RI 466..622 CDD:238064 36/156 (23%)
leucine-rich repeat 468..488 CDD:275380 7/19 (37%)
LRR_8 491..549 CDD:290566 9/57 (16%)
leucine-rich repeat 491..514 CDD:275380 1/22 (5%)
leucine-rich repeat 515..536 CDD:275380 0/20 (0%)
leucine-rich repeat 539..562 CDD:275380 8/22 (36%)
leucine-rich repeat 563..585 CDD:275380 8/22 (36%)
leucine-rich repeat 586..626 CDD:275380 9/39 (23%)
leucine-rich repeat 627..653 CDD:275380 1/25 (4%)
LRRCT 716..772 CDD:214507 11/55 (20%)
LRRNT 796..830 CDD:214470 8/57 (14%)
leucine-rich repeat 812..829 CDD:275380 4/26 (15%)
leucine-rich repeat 833..854 CDD:275380 8/28 (29%)
LRR_8 853..913 CDD:290566 14/69 (20%)
leucine-rich repeat 855..878 CDD:275380 6/32 (19%)
LRR_4 878..918 CDD:289563 9/39 (23%)
leucine-rich repeat 879..902 CDD:275380 4/22 (18%)
leucine-rich repeat 903..926 CDD:275380 6/22 (27%)
leucine-rich repeat 927..953 CDD:275380 9/29 (31%)
TIR 1098..1235 CDD:214587
VasnNP_001102852.1 LRRNT 25..55 CDD:214470
leucine-rich repeat 35..57 CDD:275380
PPP1R42 58..257 CDD:411060 71/294 (24%)
leucine-rich repeat 58..78 CDD:275380 5/19 (26%)
leucine-rich repeat 79..102 CDD:275380 9/22 (41%)
leucine-rich repeat 103..126 CDD:275380 9/22 (41%)
leucine-rich repeat 127..150 CDD:275380 7/22 (32%)
leucine-rich repeat 151..194 CDD:275380 20/93 (22%)
leucine-rich repeat 195..218 CDD:275380 8/22 (36%)
leucine-rich repeat 219..241 CDD:275380 9/36 (25%)
leucine-rich repeat 242..266 CDD:275380 4/53 (8%)
leucine-rich repeat 267..290 CDD:275380 9/34 (26%)
PCC 271..>350 CDD:188093 22/116 (19%)
EGF 410..441 CDD:394967 8/36 (22%)
fn3 469..546 CDD:394996 22/96 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.