DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-7 and Nepn

DIOPT Version :9

Sequence 1:NP_523797.1 Gene:Toll-7 / 37272 FlyBaseID:FBgn0034476 Length:1446 Species:Drosophila melanogaster
Sequence 2:XP_006512881.1 Gene:Nepn / 66650 MGIID:1913900 Length:561 Species:Mus musculus


Alignment Length:499 Identity:134/499 - (26%)
Similarity:201/499 - (40%) Gaps:108/499 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 WSY-------NGTSSVHCALRLIERQPGLDLQGADGSSQLTIQCSELYLFESTLPVAVFARLQTL 136
            |::       ||.|: :|        ||    .....|..::||..|....|.:|       .|.
Mouse    54 WAFLLGLSLTNGLSA-NC--------PG----RCSCDSMQSVQCYRLMELPSGIP-------STT 98

  Fly   137 EALRLDSCKLLQLPNNAFEGLATLKSLRLSTHNSEWGPTRTLELFPDSLGGLKQLTDLDLGDNNL 201
            :.|.:...::..|..:.|.||..|:...|....:|       .:..|:...|..|..|:|..|.|
Mouse    99 KRLYISHSRIQHLQLSNFTGLLALEDFILLASGTE-------SIENDTFKTLSTLKTLELWKNKL 156

  Fly   202 RQLPSGFLCPVGNLQVLNLTRNRIRTAEQMGFADMNCGAGSGSAGSELQVLDASHNELRSISESW 266
            ||:||..   ..||:||.|..|.|            |..    .|||.:                
Mouse   157 RQVPSAL---PANLEVLKLNDNAI------------CAL----RGSEFE---------------- 186

  Fly   267 GISRLRRLQHLNLAYNNLSELSGEALAGLASLRIVNLSNNHLETL--PEGLFAGSKELREIHLQQ 329
               .|:.|:.|.|..|.:|.||...|:.||||:.:.:..|::|::  |..|    ..|:.:.::.
Mouse   187 ---GLKNLKVLELKNNLISSLSPSMLSPLASLQSLMVDGNNIESVVGPLSL----PHLKYMSMEN 244

  Fly   330 NELYELPKGLFHRLEQLLVVDLSGNQLTSNHVDNTTFAGLIRLIVLNLAHNALTRIDYRTFKELY 394
            |:|:.:|..:|..|:.|..:..|||.||...::...     .|:.|.:..|.|..:.:|..|.|.
Mouse   245 NQLHLIPGNVFTSLQNLQFLSFSGNFLTKIPINLPK-----SLLSLKMERNQLKVVRFRDMKHLE 304

  Fly   395 FLQILNLRNNSIGHIEDNAFLPLYNLHTLNLAENRLHTLDDKL---------------------F 438
            .|..|.|..|.:..| |.| ..|.||.||.:::|:|..|..:|                     |
Mouse   305 NLSHLYLSENFLSSI-DGA-QQLTNLTTLEVSQNQLQMLPPRLPSRLQKLDCSSNFIQRVTAPEF 367

  Fly   439 NGLYVLSKLTLNNNLISVVEPAVFKNCSDLKELDLSSNQLNEVPRALQDLAMLRTLDLGENQIRT 503
            ..|..|..|.|:||::|:.|....:.||.|..|.|..|.|..:|..|.  ..|..|||..|.|:.
Mouse   368 QDLRDLKHLFLDNNVVSLFEAGALQRCSQLSNLALEQNLLLSIPLRLP--KTLARLDLKGNAIQD 430

  Fly   504 FDNQSFKNLHQLTGLRLIDNQIGNITVGMFQDLPRLSVLNLAKN 547
            ...:..::|.||..|.|.:|:|..:.....:.||||..|.|..|
Mouse   431 MAERELRDLKQLQVLNLRNNRISALDFKALEGLPRLRHLYLDGN 474

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-7NP_523797.1 LRR_8 135..201 CDD:290566 15/65 (23%)
leucine-rich repeat 136..159 CDD:275380 5/22 (23%)
leucine-rich repeat 160..190 CDD:275380 5/29 (17%)
LRR_8 189..259 CDD:290566 20/69 (29%)
leucine-rich repeat 191..214 CDD:275380 9/22 (41%)
leucine-rich repeat 215..248 CDD:275380 8/32 (25%)
LRR_RI 247..501 CDD:238064 77/276 (28%)
LRR_8 247..308 CDD:290566 16/60 (27%)
leucine-rich repeat 249..273 CDD:275380 1/23 (4%)
leucine-rich repeat 274..297 CDD:275380 9/22 (41%)
LRR_8 297..356 CDD:290566 16/60 (27%)
leucine-rich repeat 298..321 CDD:275380 5/24 (21%)
leucine-rich repeat 322..345 CDD:275380 6/22 (27%)
LRR_8 345..406 CDD:290566 17/60 (28%)
leucine-rich repeat 346..371 CDD:275380 6/24 (25%)
leucine-rich repeat 372..395 CDD:275380 7/22 (32%)
leucine-rich repeat 396..419 CDD:275380 8/22 (36%)
LRR_8 419..478 CDD:290566 23/79 (29%)
leucine-rich repeat 420..443 CDD:275380 9/43 (21%)
leucine-rich repeat 444..467 CDD:275380 8/22 (36%)
LRR_RI 466..622 CDD:238064 28/82 (34%)
leucine-rich repeat 468..488 CDD:275380 7/19 (37%)
LRR_8 491..549 CDD:290566 20/57 (35%)
leucine-rich repeat 491..514 CDD:275380 7/22 (32%)
leucine-rich repeat 515..536 CDD:275380 5/20 (25%)
leucine-rich repeat 539..562 CDD:275380 4/9 (44%)
leucine-rich repeat 563..585 CDD:275380
leucine-rich repeat 586..626 CDD:275380
leucine-rich repeat 627..653 CDD:275380
LRRCT 716..772 CDD:214507
LRRNT 796..830 CDD:214470
leucine-rich repeat 812..829 CDD:275380
leucine-rich repeat 833..854 CDD:275380
LRR_8 853..913 CDD:290566
leucine-rich repeat 855..878 CDD:275380
LRR_4 878..918 CDD:289563
leucine-rich repeat 879..902 CDD:275380
leucine-rich repeat 903..926 CDD:275380
leucine-rich repeat 927..953 CDD:275380
TIR 1098..1235 CDD:214587
NepnXP_006512881.1 leucine-rich repeat 101..121 CDD:275380 5/19 (26%)
leucine-rich repeat 122..145 CDD:275380 5/29 (17%)
leucine-rich repeat 146..166 CDD:275380 9/22 (41%)
PRK15370 <148..>367 CDD:185268 71/267 (27%)
leucine-rich repeat 167..190 CDD:275380 11/57 (19%)
leucine-rich repeat 191..214 CDD:275380 9/22 (41%)
leucine-rich repeat 215..236 CDD:275380 5/24 (21%)
leucine-rich repeat 237..260 CDD:275380 6/22 (27%)
leucine-rich repeat 261..305 CDD:275380 13/48 (27%)
PRK15370 <271..>474 CDD:185268 62/211 (29%)
leucine-rich repeat 282..297 CDD:275380 4/14 (29%)
leucine-rich repeat 306..327 CDD:275380 8/22 (36%)
leucine-rich repeat 328..348 CDD:275380 7/19 (37%)
leucine-rich repeat 349..372 CDD:275380 2/22 (9%)
leucine-rich repeat 373..396 CDD:275380 8/22 (36%)
leucine-rich repeat 397..420 CDD:275380 8/24 (33%)
leucine-rich repeat 421..441 CDD:275380 6/19 (32%)
leucine-rich repeat 442..465 CDD:275380 6/22 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.