DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Toll-7 and lgi1b

DIOPT Version :9

Sequence 1:	NP_523797.1	Gene:	Toll-7 / 37272	FlyBaseID:	FBgn0034476	Length:	1446	Species:	Drosophila melanogaster
Sequence 2:	NP_001122241.1	Gene:	lgi1b / 654829	ZFINID:	ZDB-GENE-060217-1	Length:	543	Species:	Danio rerio

Alignment Length:	206	Identity:	45/206 - (21%)
Similarity:	72/206 - (34%)	Gaps:	39/206 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly   796 CPSNCTCYHDQIWSTNVVDCGGQQTTELPRRVPMDSSVVYLDGNNFPVLKNHAFIGRKNLRALYV 860
            |||.|||..|.....||        ..:|...|.|...:....:.|..:...:|:...:|:.|..
Zfish    34 CPSGCTCTKDNALCENV--------RSVPHSFPPDVISLSFVKSGFSEIAGGSFLHTPSLQLLLF 90

  Fly   861 NGSQVAAIQNRTFASLASLQLLHLADNKLRTLHGYEFEQLSALRELYLQNNQLTTIENATLAPLA 925
            ..:....|....|..|..|:.|.:.:||:.::..:.|..|.:|..|.|..|.|.|:.......:.
Zfish    91 TANSFDLIDEDAFQGLPHLEYLFIENNKIESISPHAFRGLKSLIHLSLAYNNLETLPRDIFKGMD 155

  Fly   926 ALELIRIDGNRLVTLPIWQMHATHFGTRLKSISLGRNQWSCRCQFLQALTSYVADNALIVQDAQD 990
            ||..:.:.|                           |.:||.|:....:....:.||.:.|
Zfish   156 ALTKVDLRG---------------------------NLFSCDCKLKWLVEWMFSTNATVDQ---- 189

  Fly   991 IYCMAASSGTG 1001
            :||...|...|
Zfish   190 LYCSGPSPYQG 200

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Toll-7	NP_523797.1	LRR_8	135..201	CDD:290566
		leucine-rich repeat	136..159	CDD:275380
		leucine-rich repeat	160..190	CDD:275380
		LRR_8	189..259	CDD:290566
		leucine-rich repeat	191..214	CDD:275380
		leucine-rich repeat	215..248	CDD:275380
		LRR_RI	247..501	CDD:238064
		LRR_8	247..308	CDD:290566
		leucine-rich repeat	249..273	CDD:275380
		leucine-rich repeat	274..297	CDD:275380
		LRR_8	297..356	CDD:290566
		leucine-rich repeat	298..321	CDD:275380
		leucine-rich repeat	322..345	CDD:275380
		LRR_8	345..406	CDD:290566
		leucine-rich repeat	346..371	CDD:275380
		leucine-rich repeat	372..395	CDD:275380
		leucine-rich repeat	396..419	CDD:275380
		LRR_8	419..478	CDD:290566
		leucine-rich repeat	420..443	CDD:275380
		leucine-rich repeat	444..467	CDD:275380
		LRR_RI	466..622	CDD:238064
		leucine-rich repeat	468..488	CDD:275380
		LRR_8	491..549	CDD:290566
		leucine-rich repeat	491..514	CDD:275380
		leucine-rich repeat	515..536	CDD:275380
		leucine-rich repeat	539..562	CDD:275380
		leucine-rich repeat	563..585	CDD:275380
		leucine-rich repeat	586..626	CDD:275380
		leucine-rich repeat	627..653	CDD:275380
		LRRCT	716..772	CDD:214507
		LRRNT	796..830	CDD:214470	11/33 (33%)
		leucine-rich repeat	812..829	CDD:275380	2/16 (13%)
		leucine-rich repeat	833..854	CDD:275380	2/20 (10%)
		LRR_8	853..913	CDD:290566	15/59 (25%)
		leucine-rich repeat	855..878	CDD:275380	5/22 (23%)
		LRR_4	878..918	CDD:289563	12/39 (31%)
		leucine-rich repeat	879..902	CDD:275380	6/22 (27%)
		leucine-rich repeat	903..926	CDD:275380	6/22 (27%)
		leucine-rich repeat	927..953	CDD:275380	2/25 (8%)
		TIR	1098..1235	CDD:214587
lgi1b	NP_001122241.1	LRR_8	83..143	CDD:290566	15/59 (25%)
		LRR_4	83..124	CDD:289563	9/40 (23%)
		leucine-rich repeat	85..108	CDD:275378	5/22 (23%)
		LRR_4	107..147	CDD:289563	12/39 (31%)
		leucine-rich repeat	109..132	CDD:275378	6/22 (27%)
		leucine-rich repeat	133..156	CDD:275378	6/22 (27%)
		leucine-rich repeat	157..169	CDD:275378	3/38 (8%)
		LRRCT	165..213	CDD:214507	11/40 (28%)
		EPTP	217..258	CDD:281697
		EPTP	263..304	CDD:281697
		EPTP	309..355	CDD:281697
		EPTP	358..400	CDD:281697
		EPTP	405..447	CDD:281697
		EPTP	450..491	CDD:281697
		EPTP	496..536	CDD:281697
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	0	0.000