DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-7 and LINGO3

DIOPT Version :9

Sequence 1:NP_523797.1 Gene:Toll-7 / 37272 FlyBaseID:FBgn0034476 Length:1446 Species:Drosophila melanogaster
Sequence 2:NP_001094861.1 Gene:LINGO3 / 645191 HGNCID:21206 Length:592 Species:Homo sapiens


Alignment Length:420 Identity:110/420 - (26%)
Similarity:176/420 - (41%) Gaps:71/420 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 PTRTLELFPDSLGGLKQLTDLDLGDNNLRQLPSGFLCPVGNLQVLNLTRNRIRTAEQMGFADMNC 238
            |...|...|...||                .|:...|.| ..:.:..||.|: ||...|..    
Human    11 PLLLLPAAPPPAGG----------------CPARCECTV-QTRAVACTRRRL-TAVPDGIP---- 53

  Fly   239 GAGSGSAGSELQVLDASHNELRSISESWGISRLRRLQHLNLAYNNLSELSGEALAGLASLRIVNL 303
                    :|.::|:.|.|.:|.::.. .::.|..|:.|:|:.|.::.:...|.|.|..||::.|
Human    54 --------AETRLLELSRNRIRCLNPG-DLAALPALEELDLSENAIAHVEPGAFANLPRLRVLRL 109

  Fly   304 SNNHLETLPEGLFAGSKELREIHLQQNELYELPKGLFHRLEQLLVVDLSGNQLTSNHVDNTTFAG 368
            ..|.|:.:|.|:|.....|..:.|.:|:|..|....|..|..|..:::..|.|.  .|....|||
Human   110 RGNQLKLIPPGVFTRLDNLTLLDLSENKLVILLDYTFQDLHSLRRLEVGDNDLV--FVSRRAFAG 172

  Fly   369 LIRLIVLNLAHNALTRIDYRTFKELYFLQILNLRNNSIGHIEDNAFLPLYNLHTLNLAENRLHTL 433
            |:.|..|.|....||.:...:...|..|..|.||:.:|..:||..|..|..|  |:|..:....|
Human   173 LLALEELTLERCNLTALSGESLGHLRSLGALRLRHLAIASLEDQNFRRLPGL--LHLEIDNWPLL 235

  Fly   434 DDKLFNGL--YVLSKLTLNNNLISVVEPAVFKNCSDLKELDLSSNQLNEVPR-ALQDLAMLRTLD 495
            ::.....|  ..|:.|::.:..|:.|..|..::.:.|..|:||.|.::.||| :.:||..||.|.
Human   236 EEVAAGSLRGLNLTSLSVTHTNITAVPAAALRHQAHLTCLNLSHNPISTVPRGSFRDLVRLRELH 300

  Fly   496 LGENQIRTFDNQSFKNLHQLTGLRLIDNQIGNITVGMFQDLPRLSVLNLAKNRIQSIERGSFDKN 560
            |....:...:.|:|..|.|                        :.:|||:.|.:.::|..:|...
Human   301 LAGALLAVVEPQAFLGLRQ------------------------IRLLNLSNNLLSTLEESTFHSV 341

  Fly   561 FELEAIRLDRNFLA-DINGVFATLVSLLWL 589
            ..||.:|:|.|.|| |..        |||:
Human   342 NTLETLRVDGNPLACDCR--------LLWI 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-7NP_523797.1 LRR_8 135..201 CDD:290566 5/26 (19%)
leucine-rich repeat 136..159 CDD:275380
leucine-rich repeat 160..190 CDD:275380 5/15 (33%)
LRR_8 189..259 CDD:290566 13/69 (19%)
leucine-rich repeat 191..214 CDD:275380 3/22 (14%)
leucine-rich repeat 215..248 CDD:275380 6/32 (19%)
LRR_RI 247..501 CDD:238064 75/256 (29%)
LRR_8 247..308 CDD:290566 17/60 (28%)
leucine-rich repeat 249..273 CDD:275380 5/23 (22%)
leucine-rich repeat 274..297 CDD:275380 7/22 (32%)
LRR_8 297..356 CDD:290566 17/58 (29%)
leucine-rich repeat 298..321 CDD:275380 8/22 (36%)
leucine-rich repeat 322..345 CDD:275380 7/22 (32%)
LRR_8 345..406 CDD:290566 18/60 (30%)
leucine-rich repeat 346..371 CDD:275380 8/24 (33%)
leucine-rich repeat 372..395 CDD:275380 6/22 (27%)
leucine-rich repeat 396..419 CDD:275380 9/22 (41%)
LRR_8 419..478 CDD:290566 15/60 (25%)
leucine-rich repeat 420..443 CDD:275380 5/24 (21%)
leucine-rich repeat 444..467 CDD:275380 5/22 (23%)
LRR_RI 466..622 CDD:238064 35/126 (28%)
leucine-rich repeat 468..488 CDD:275380 8/20 (40%)
LRR_8 491..549 CDD:290566 12/57 (21%)
leucine-rich repeat 491..514 CDD:275380 7/22 (32%)
leucine-rich repeat 515..536 CDD:275380 0/20 (0%)
leucine-rich repeat 539..562 CDD:275380 6/22 (27%)
leucine-rich repeat 563..585 CDD:275380 8/22 (36%)
leucine-rich repeat 586..626 CDD:275380 3/4 (75%)
leucine-rich repeat 627..653 CDD:275380
LRRCT 716..772 CDD:214507
LRRNT 796..830 CDD:214470
leucine-rich repeat 812..829 CDD:275380
leucine-rich repeat 833..854 CDD:275380
LRR_8 853..913 CDD:290566
leucine-rich repeat 855..878 CDD:275380
LRR_4 878..918 CDD:289563
leucine-rich repeat 879..902 CDD:275380
leucine-rich repeat 903..926 CDD:275380
leucine-rich repeat 927..953 CDD:275380
TIR 1098..1235 CDD:214587
LINGO3NP_001094861.1 LRRNT 24..58 CDD:214470 11/63 (17%)
LRR 1 55..76 5/21 (24%)
LRR_8 57..138 CDD:290566 23/81 (28%)
LRR_4 59..95 CDD:289563 9/36 (25%)
leucine-rich repeat 59..79 CDD:275380 5/20 (25%)
LRR 2 79..100 5/20 (25%)
leucine-rich repeat 80..103 CDD:275380 7/22 (32%)
LRR 3 103..124 8/20 (40%)
leucine-rich repeat 104..127 CDD:275380 8/22 (36%)
LRR_RI 111..>286 CDD:238064 50/178 (28%)
LRR_8 127..>172 CDD:290566 12/46 (26%)
LRR 4 127..148 6/20 (30%)
leucine-rich repeat 128..151 CDD:275380 7/22 (32%)
LRR 5 151..172 5/22 (23%)
leucine-rich repeat 152..199 CDD:275380 14/48 (29%)
LRR 6 175..196 5/20 (25%)
LRR_8 198..258 CDD:290566 16/61 (26%)
leucine-rich repeat 200..223 CDD:275380 9/22 (41%)
LRR 7 207..228 7/22 (32%)
leucine-rich repeat 224..247 CDD:275380 5/24 (21%)
LRR_8 247..303 CDD:290566 19/55 (35%)
LRR 8 247..268 5/20 (25%)
leucine-rich repeat 248..271 CDD:275380 5/22 (23%)
LRR 9 271..292 8/20 (40%)
leucine-rich repeat 272..293 CDD:275380 8/20 (40%)
LRR 10 295..316 6/20 (30%)
leucine-rich repeat 296..319 CDD:275380 7/22 (32%)
LRR 11 319..340 7/44 (16%)
leucine-rich repeat 322..343 CDD:275380 6/20 (30%)
I-set 407..497 CDD:254352
Ig 422..490 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.