DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-7 and Lgr6

DIOPT Version :9

Sequence 1:NP_523797.1 Gene:Toll-7 / 37272 FlyBaseID:FBgn0034476 Length:1446 Species:Drosophila melanogaster
Sequence 2:NP_001028581.1 Gene:Lgr6 / 329252 MGIID:2441805 Length:967 Species:Mus musculus


Alignment Length:433 Identity:127/433 - (29%)
Similarity:186/433 - (42%) Gaps:71/433 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 HLNLAYNNLSELSGEALAGLASLRIVNLSNNHLETLPEGLFAGSKELREIHLQQNELYELPKGLF 340
            :|:|:.|||:||.......|..|..:.||.|||..:|...|:|...|:.:.||.|:|..:|....
Mouse    70 YLDLSMNNLTELQPGLFHHLRFLEELRLSGNHLSHIPGQAFSGLHSLKILMLQSNQLRGIPAEAL 134

  Fly   341 HRLEQLLVVDLSGNQLTSNHVDNTTFAGLIRLIVLNLAHNALTRIDYRTFKELYFLQILNLRNNS 405
            ..|..|..:.|..|.::.  |...:|.||..|..|.|..||||.|..|....|..||.:.|..|.
Mouse   135 WELPSLQSLRLDANLISL--VPERSFEGLSSLRHLWLDDNALTEIPVRALNNLPALQAMTLALNH 197

  Fly   406 IGHIEDNAFLPLYNLHTLNLAENRLHTLDDKLFNGLYVLSKLTLNNNLISVVEPAVFKNCSDLKE 470
            |.||.|.||..|.:|..|:|..||:..:....|.||:                        :|:.
Mouse   198 IRHIPDYAFQNLTSLVVLHLHNNRIQHVGTHSFEGLH------------------------NLET 238

  Fly   471 LDLSSNQLNEVPRALQDLAMLRTLDLGENQIRTFDNQSFKNLHQLTGLRLIDNQIGNITVGMFQD 535
            |||:.|:|.|.|.|::.|..|:.|....|.|:....::|.....|..:...||.|..:....||.
Mouse   239 LDLNYNELQEFPLAIRTLGRLQELGFHNNNIKAIPEKAFMGSPLLQTIHFYDNPIQFVGRSAFQY 303

  Fly   536 LPRLSVLNLAKNRIQSIERGSFDKNFELEAIRLDRNFLADINGVFATLVSLLWLNLSENHLVWFD 600
            |.:|..|:|  |....|:.                  ..|:.|  .|.:.:|.|..:...|    
Mouse   304 LSKLHTLSL--NGATDIQE------------------FPDLKG--TTSLEILTLTRAGIRL---- 342

  Fly   601 YAFIP-------SNLKWLDIHGNYIEALGNYYKLQ--EEIRVKTLDASHNRITEIG--PMSIPNT 654
               :|       ..|:.|::..|.||.|.:.::.|  |||.::     ||||.|||  ..|...:
Mouse   343 ---LPPGVCQQLPRLRILELSHNQIEELPSLHRCQKLEEIGLR-----HNRIKEIGADTFSQLGS 399

  Fly   655 IELLFINNNLIGNVQPNAFVDKANLARVDLYANQLSKLQLQQL 697
            ::.|.::.|.|..:.|.||....:|.::||..|||:.|.|..|
Mouse   400 LQALDLSWNAIRAIHPEAFSTLRSLVKLDLTDNQLTTLPLAGL 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-7NP_523797.1 LRR_8 135..201 CDD:290566
leucine-rich repeat 136..159 CDD:275380
leucine-rich repeat 160..190 CDD:275380
LRR_8 189..259 CDD:290566
leucine-rich repeat 191..214 CDD:275380
leucine-rich repeat 215..248 CDD:275380
LRR_RI 247..501 CDD:238064 73/224 (33%)
LRR_8 247..308 CDD:290566 12/31 (39%)
leucine-rich repeat 249..273 CDD:275380
leucine-rich repeat 274..297 CDD:275380 8/20 (40%)
LRR_8 297..356 CDD:290566 19/58 (33%)
leucine-rich repeat 298..321 CDD:275380 9/22 (41%)
leucine-rich repeat 322..345 CDD:275380 7/22 (32%)
LRR_8 345..406 CDD:290566 21/60 (35%)
leucine-rich repeat 346..371 CDD:275380 7/24 (29%)
leucine-rich repeat 372..395 CDD:275380 10/22 (45%)
leucine-rich repeat 396..419 CDD:275380 11/22 (50%)
LRR_8 419..478 CDD:290566 13/58 (22%)
leucine-rich repeat 420..443 CDD:275380 8/22 (36%)
leucine-rich repeat 444..467 CDD:275380 0/22 (0%)
LRR_RI 466..622 CDD:238064 39/162 (24%)
leucine-rich repeat 468..488 CDD:275380 9/19 (47%)
LRR_8 491..549 CDD:290566 16/57 (28%)
leucine-rich repeat 491..514 CDD:275380 5/22 (23%)
leucine-rich repeat 515..536 CDD:275380 6/20 (30%)
leucine-rich repeat 539..562 CDD:275380 5/22 (23%)
leucine-rich repeat 563..585 CDD:275380 3/21 (14%)
leucine-rich repeat 586..626 CDD:275380 10/46 (22%)
leucine-rich repeat 627..653 CDD:275380 12/29 (41%)
LRRCT 716..772 CDD:214507
LRRNT 796..830 CDD:214470
leucine-rich repeat 812..829 CDD:275380
leucine-rich repeat 833..854 CDD:275380
LRR_8 853..913 CDD:290566
leucine-rich repeat 855..878 CDD:275380
LRR_4 878..918 CDD:289563
leucine-rich repeat 879..902 CDD:275380
leucine-rich repeat 903..926 CDD:275380
leucine-rich repeat 927..953 CDD:275380
TIR 1098..1235 CDD:214587
Lgr6NP_001028581.1 LRRNT 34..68 CDD:214470
LRR_4 70..107 CDD:289563 14/36 (39%)
leucine-rich repeat 70..91 CDD:275380 8/20 (40%)
LRR 1 91..112 8/20 (40%)
LRR_8 92..150 CDD:290566 19/57 (33%)
LRR_4 92..131 CDD:289563 14/38 (37%)
leucine-rich repeat 92..115 CDD:275380 9/22 (41%)
LRR 2 115..136 6/20 (30%)
leucine-rich repeat 116..139 CDD:275380 7/22 (32%)
LRR_8 138..198 CDD:290566 21/61 (34%)
LRR 3 139..160 5/22 (23%)
leucine-rich repeat 140..163 CDD:275380 7/24 (29%)
LRR_RI 143..392 CDD:238064 86/308 (28%)
LRR 4 163..186 9/22 (41%)
leucine-rich repeat 164..187 CDD:275380 10/22 (45%)
LRR_8 186..246 CDD:290566 24/83 (29%)
LRR 5 187..208 10/20 (50%)
leucine-rich repeat 188..211 CDD:275380 11/22 (50%)
LRR 6 211..232 6/20 (30%)
leucine-rich repeat 212..235 CDD:275380 8/46 (17%)
LRR 7 235..256 9/20 (45%)
leucine-rich repeat 236..258 CDD:275380 10/21 (48%)
LRR_8 258..314 CDD:290566 15/57 (26%)
LRR 8 258..279 5/20 (25%)
leucine-rich repeat 259..282 CDD:275380 5/22 (23%)
LRR 9 282..302 4/19 (21%)
leucine-rich repeat 283..304 CDD:275380 6/20 (30%)
LRR 10 303..325 7/41 (17%)
LRR_8 305..364 CDD:290566 15/87 (17%)
leucine-rich repeat 307..348 CDD:275380 12/69 (17%)
LRR 11 329..350 4/27 (15%)
LRR 12 353..374 6/20 (30%)
leucine-rich repeat 354..375 CDD:275380 6/20 (30%)
LRR_8 375..434 CDD:290566 21/63 (33%)
LRR 13 375..396 10/25 (40%)
leucine-rich repeat 376..399 CDD:275380 11/27 (41%)
LRR 14 399..420 6/20 (30%)
leucine-rich repeat 400..421 CDD:275380 6/20 (30%)
LRR 15 423..443 9/20 (45%)
leucine-rich repeat 424..444 CDD:275380 9/19 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.