DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-7 and Rtn4rl2

DIOPT Version :9

Sequence 1:NP_523797.1 Gene:Toll-7 / 37272 FlyBaseID:FBgn0034476 Length:1446 Species:Drosophila melanogaster
Sequence 2:NP_852045.1 Gene:Rtn4rl2 / 311169 RGDID:727797 Length:420 Species:Rattus norvegicus


Alignment Length:220 Identity:79/220 - (35%)
Similarity:106/220 - (48%) Gaps:9/220 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   282 NNLSELSGEALAGLASLRIVNLSNNHLETLPEGLFAGSKELREIHLQQNELYELPKGLFHRLEQL 346
            ||.|.:   .|:...|.:.:.|.||.:.:|..|.|  ...|..:.|..|.|..:..|.|..|:.|
  Rat    49 NNFSSV---PLSLPPSTQRLFLQNNLIRSLRPGTF--GPNLLTLWLFSNNLSTIYPGTFRHLQAL 108

  Fly   347 LVVDLSGNQ-LTSNHVDNTTFAGLIRLIVLNLAHNALTRIDYRTFKELYFLQILNLRNNSIGHIE 410
            ..:||..|: |.|...|  ||.||.||..|:|....|:.:....|:.|..||.|.|:.||:.|::
  Rat   109 EELDLGDNRHLRSLEPD--TFQGLERLQSLHLYRCQLSSLPGNIFRGLVSLQYLYLQENSLLHLQ 171

  Fly   411 DNAFLPLYNLHTLNLAENRLHTLDDKLFNGLYVLSKLTLNNNLISVVEPAVFKNCSDLKELDLSS 475
            |:.|..|.||..|.|..|||..|.:.:|.||..|.:|.|:.|.:..|..|.|...|.|..|.|.:
  Rat   172 DDLFADLANLSHLFLHGNRLRLLTEHVFRGLGSLDRLLLHGNRLQGVHRAAFHGLSRLTILYLFN 236

  Fly   476 NQLNEVP-RALQDLAMLRTLDLGEN 499
            |.|..:| .||.||..|..|.|..|
  Rat   237 NSLASLPGEALADLPALEFLRLNAN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-7NP_523797.1 LRR_8 135..201 CDD:290566
leucine-rich repeat 136..159 CDD:275380
leucine-rich repeat 160..190 CDD:275380
LRR_8 189..259 CDD:290566
leucine-rich repeat 191..214 CDD:275380
leucine-rich repeat 215..248 CDD:275380
LRR_RI 247..501 CDD:238064 79/220 (36%)
LRR_8 247..308 CDD:290566 8/25 (32%)
leucine-rich repeat 249..273 CDD:275380
leucine-rich repeat 274..297 CDD:275380 4/14 (29%)
LRR_8 297..356 CDD:290566 18/59 (31%)
leucine-rich repeat 298..321 CDD:275380 6/22 (27%)
leucine-rich repeat 322..345 CDD:275380 7/22 (32%)
LRR_8 345..406 CDD:290566 23/61 (38%)
leucine-rich repeat 346..371 CDD:275380 11/25 (44%)
leucine-rich repeat 372..395 CDD:275380 6/22 (27%)
leucine-rich repeat 396..419 CDD:275380 10/22 (45%)
LRR_8 419..478 CDD:290566 23/58 (40%)
leucine-rich repeat 420..443 CDD:275380 10/22 (45%)
leucine-rich repeat 444..467 CDD:275380 7/22 (32%)
LRR_RI 466..622 CDD:238064 15/35 (43%)
leucine-rich repeat 468..488 CDD:275380 8/20 (40%)
LRR_8 491..549 CDD:290566 4/9 (44%)
leucine-rich repeat 491..514 CDD:275380 4/9 (44%)
leucine-rich repeat 515..536 CDD:275380
leucine-rich repeat 539..562 CDD:275380
leucine-rich repeat 563..585 CDD:275380
leucine-rich repeat 586..626 CDD:275380
leucine-rich repeat 627..653 CDD:275380
LRRCT 716..772 CDD:214507
LRRNT 796..830 CDD:214470
leucine-rich repeat 812..829 CDD:275380
leucine-rich repeat 833..854 CDD:275380
LRR_8 853..913 CDD:290566
leucine-rich repeat 855..878 CDD:275380
LRR_4 878..918 CDD:289563
leucine-rich repeat 879..902 CDD:275380
leucine-rich repeat 903..926 CDD:275380
leucine-rich repeat 927..953 CDD:275380
TIR 1098..1235 CDD:214587
Rtn4rl2NP_852045.1 LRR_8 60..117 CDD:290566 17/58 (29%)
LRR 1 61..82 7/22 (32%)
leucine-rich repeat 62..83 CDD:275380 6/22 (27%)
LRR 2 83..104 6/20 (30%)
leucine-rich repeat 84..107 CDD:275380 7/22 (32%)
LRR_RI 103..>261 CDD:238064 61/159 (38%)
LRR 3 107..129 9/23 (39%)
LRR_8 108..167 CDD:290566 23/60 (38%)
leucine-rich repeat 108..132 CDD:275380 11/25 (44%)
LRR 4 132..153 6/20 (30%)
leucine-rich repeat 133..156 CDD:275380 6/22 (27%)
LRR_8 156..215 CDD:290566 25/58 (43%)
LRR 5 156..177 9/20 (45%)
leucine-rich repeat 157..180 CDD:275380 10/22 (45%)
LRR 6 180..201 9/20 (45%)
leucine-rich repeat 181..204 CDD:275380 10/22 (45%)
LRR_8 204..262 CDD:290566 22/58 (38%)
LRR 7 204..225 7/20 (35%)
leucine-rich repeat 205..228 CDD:275380 7/22 (32%)
LRR 8 228..249 8/20 (40%)
leucine-rich repeat 229..252 CDD:275380 10/22 (45%)
TPKR_C2 261..311 CDD:301599 1/1 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 286..390
Important for interaction with MAG. /evidence=ECO:0000269|PubMed:19420245 315..327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.