DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-7 and Lrrn2

DIOPT Version :9

Sequence 1:NP_523797.1 Gene:Toll-7 / 37272 FlyBaseID:FBgn0034476 Length:1446 Species:Drosophila melanogaster
Sequence 2:NP_001170839.1 Gene:Lrrn2 / 289020 RGDID:1305482 Length:750 Species:Rattus norvegicus


Alignment Length:501 Identity:120/501 - (23%)
Similarity:185/501 - (36%) Gaps:125/501 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 VNLSNNHLETLPEGLFAGSKELREIHLQQNELYELPKGLFHRLEQLLVVDLSGNQLTSNHVDNTT 365
            |:.::..|..:|.||.||::.|.   ||.|.:..:.:.....|..|..:|||.|..:.  ..:..
  Rat    53 VDCNDLFLTAVPPGLPAGTQTLL---LQSNSISRIEQTELGYLANLTELDLSQNSFSD--ARDCD 112

  Fly   366 FAGLIRLIVLNLAHNALTRIDYRTFKELYFLQILNLRNNSIGHIEDNAFLPLYNLHTLNLAENRL 430
            |..|.:|:.|:|..|.|:|::..:|..|..||.|.|.:|.:..|...||..|.||..|:|..|.|
  Rat   113 FQALPQLLSLHLEENQLSRLEDHSFAGLTRLQELYLNHNQLCRISPRAFEGLGNLLRLHLNSNLL 177

  Fly   431 HTLDDKLFNGLYVLSKLTLNNNLISVVEPAVFKNCSDLKELDLSSNQLNEVPRALQDLAMLRTLD 495
            .|:|.:.|..|..|..|.:..|.:..:             ||::          .:.||.||:|.
  Rat   178 RTIDSRWFEMLPNLEILMIGGNKVDAI-------------LDMN----------FRPLANLRSLV 219

  Fly   496 LGENQIRTFDNQSFKNLHQLTGLRLIDNQIGNITVGMFQDLPRLSVLNLAKNRIQSIERGSFDKN 560
            |....:|...:.:.:.|..|..|...|||:..:.....:.:|.|..|:|.||.:|.:..|.|...
  Rat   220 LAGMSLREISDYALEGLQSLESLSFYDNQLAQVPKRALEQVPGLKFLDLNKNPLQRVGPGDFANM 284

  Fly   561 FELEAIRLDRNFLADINGVFATLVSLLWLNLSENHLVWFD-YAFIPSNLKWLDIHGNYIEALGNY 624
            ..|:.:.|:                    |:.|  ||..| :|.:                    
  Rat   285 LHLKELGLN--------------------NMEE--LVSIDKFALV-------------------- 307

  Fly   625 YKLQEEIRVKTLDASHNRITEIGPMSIPNTIELLFINNNLIGNVQPNAFVDKANLARVDLYANQL 689
                                     ::|...:|...||..:..:.|.||.....:..:.|..|.|
  Rat   308 -------------------------NLPELTKLDITNNPRLSFIHPRAFHHLPQMETLMLNNNAL 347

  Fly   690 SKLQLQQLRVAPVVAPKPLPEFYLGGNPFECDCTMDWLQRINNLTTRQHPRVMDMANIECVMP-- 752
            |.|..|.:...|     .|.|..|.|||..|||.:.|..     .|..|.|.::..:..|..|  
  Rat   348 SALHQQTVESLP-----NLQEVGLHGNPIRCDCVIRWAN-----ATGTHVRFIEPQSTLCAEPPD 402

  Fly   753 ----HARGAAVRPLSG-----LRPQDF-----LCRYES---HCFAL 781
                ..|....|.::.     :.|:.|     :...||   ||.||
  Rat   403 LQRRPVREVPFREMTDHCLPLISPRSFPSSLQVASGESLVLHCRAL 448

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-7NP_523797.1 LRR_8 135..201 CDD:290566
leucine-rich repeat 136..159 CDD:275380
leucine-rich repeat 160..190 CDD:275380
LRR_8 189..259 CDD:290566
leucine-rich repeat 191..214 CDD:275380
leucine-rich repeat 215..248 CDD:275380
LRR_RI 247..501 CDD:238064 57/199 (29%)
LRR_8 247..308 CDD:290566 1/6 (17%)
leucine-rich repeat 249..273 CDD:275380
leucine-rich repeat 274..297 CDD:275380
LRR_8 297..356 CDD:290566 17/54 (31%)
leucine-rich repeat 298..321 CDD:275380 7/19 (37%)
leucine-rich repeat 322..345 CDD:275380 5/22 (23%)
LRR_8 345..406 CDD:290566 20/60 (33%)
leucine-rich repeat 346..371 CDD:275380 7/24 (29%)
leucine-rich repeat 372..395 CDD:275380 8/22 (36%)
leucine-rich repeat 396..419 CDD:275380 9/22 (41%)
LRR_8 419..478 CDD:290566 15/58 (26%)
leucine-rich repeat 420..443 CDD:275380 9/22 (41%)
leucine-rich repeat 444..467 CDD:275380 3/22 (14%)
LRR_RI 466..622 CDD:238064 32/156 (21%)
leucine-rich repeat 468..488 CDD:275380 2/19 (11%)
LRR_8 491..549 CDD:290566 17/57 (30%)
leucine-rich repeat 491..514 CDD:275380 6/22 (27%)
leucine-rich repeat 515..536 CDD:275380 5/20 (25%)
leucine-rich repeat 539..562 CDD:275380 8/22 (36%)
leucine-rich repeat 563..585 CDD:275380 2/21 (10%)
leucine-rich repeat 586..626 CDD:275380 6/40 (15%)
leucine-rich repeat 627..653 CDD:275380 0/25 (0%)
LRRCT 716..772 CDD:214507 15/71 (21%)
LRRNT 796..830 CDD:214470
leucine-rich repeat 812..829 CDD:275380
leucine-rich repeat 833..854 CDD:275380
LRR_8 853..913 CDD:290566
leucine-rich repeat 855..878 CDD:275380
LRR_4 878..918 CDD:289563
leucine-rich repeat 879..902 CDD:275380
leucine-rich repeat 903..926 CDD:275380
leucine-rich repeat 927..953 CDD:275380
TIR 1098..1235 CDD:214587
Lrrn2NP_001170839.1 LRR_RI 46..288 CDD:238064 73/262 (28%)
leucine-rich repeat 51..69 CDD:275380 5/15 (33%)
leucine-rich repeat 71..94 CDD:275380 5/25 (20%)
leucine-rich repeat 95..118 CDD:275380 7/24 (29%)
LRR_8 117..177 CDD:290566 22/59 (37%)
leucine-rich repeat 119..142 CDD:275380 8/22 (36%)
leucine-rich repeat 143..166 CDD:275380 9/22 (41%)
LRR_8 166..222 CDD:290566 21/78 (27%)
leucine-rich repeat 167..190 CDD:275380 9/22 (41%)
leucine-rich repeat 191..214 CDD:275380 6/45 (13%)
LRR_RI 214..>372 CDD:238064 48/229 (21%)
LRR_8 214..273 CDD:290566 17/58 (29%)
leucine-rich repeat 215..238 CDD:275380 6/22 (27%)
leucine-rich repeat 239..262 CDD:275380 5/22 (23%)
leucine-rich repeat 263..286 CDD:275380 8/22 (36%)
leucine-rich repeat 287..311 CDD:275380 8/90 (9%)
LRR_8 310..371 CDD:290566 19/65 (29%)
leucine-rich repeat 312..334 CDD:275380 6/21 (29%)
leucine-rich repeat 337..360 CDD:275378 7/27 (26%)
leucine-rich repeat 361..373 CDD:275378 6/11 (55%)
TPKR_C2 369..412 CDD:301599 12/47 (26%)
I-set 430..514 CDD:254352 6/19 (32%)
Ig 438..514 CDD:299845 6/11 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.