DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-7 and GP5

DIOPT Version :9

Sequence 1:NP_523797.1 Gene:Toll-7 / 37272 FlyBaseID:FBgn0034476 Length:1446 Species:Drosophila melanogaster
Sequence 2:NP_004479.1 Gene:GP5 / 2814 HGNCID:4443 Length:560 Species:Homo sapiens


Alignment Length:441 Identity:127/441 - (28%)
Similarity:192/441 - (43%) Gaps:42/441 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   201 LRQLPSGFLCP-----------------VGNLQVLNLTRNRIRTAEQMGFADMNCGAGSGSAGSE 248
            ||..|  |.||                 |..:..|.|..|....        :..|.|.|...|:
Human    14 LRAQP--FPCPPACKCVFRDAAQCSGGDVARISALGLPTNLTHI--------LLFGMGRGVLQSQ 68

  Fly   249 -------LQVLDASHNELRSISESWGISRLRRLQHLNLAYNNLSELSGEALAGLASLRIVNLSNN 306
                   ||.|..|.:.:.:::.. ..|.|.:|:.|.|:.|.::.|.|..|..:..|..:.|.:|
Human    69 SFSGMTVLQRLMISDSHISAVAPG-TFSDLIKLKTLRLSRNKITHLPGALLDKMVLLEQLFLDHN 132

  Fly   307 HLETLPEGLFAGSKELREIHLQQNELYELPKGLFHRLEQLLVVDLSGNQLTSNHVDNTTFAGLIR 371
            .|..:.:.:|.....|:|:.|.||:|..||..||..||.|.::|||||.||  |:.........:
Human   133 ALRGIDQNMFQKLVNLQELALNQNQLDFLPASLFTNLENLKLLDLSGNNLT--HLPKGLLGAQAK 195

  Fly   372 LIVLNLAHNALTRIDYRTFKELYFLQILNLRNNSIGHIEDNAFLPLYNLHTLNLAENRLHTLDDK 436
            |..|.|..|.|..:|......|..|..|....|.|..|...||..|.||.:|.|:.|.|..|...
Human   196 LERLLLHSNRLVSLDSGLLNSLGALTELQFHRNHIRSIAPGAFDRLPNLSSLTLSRNHLAFLPSA 260

  Fly   437 LFNGLYVLSKLTLNNNLISVVEPAVFKNCSDLKELDLSSNQLNEVP-RALQDLAMLRTLDLG-EN 499
            ||...:.|:.|||..|.::.:...:|.....|:||.|:..||..:| .|.::|:.||.|.:. ..
Human   261 LFLHSHNLTLLTLFENPLAELPGVLFGEMGGLQELWLNRTQLRTLPAAAFRNLSRLRYLGVTLSP 325

  Fly   500 QIRTFDNQSFKNLHQLTGLRLIDNQIGNITVGMFQDLPRLSVLNLAKNRIQSIERGSFDKNFELE 564
            ::......:|:.|.:|..|.|..|.:..:..|:.:.|.:|..::|.:||::::.|..|.....||
Human   326 RLSALPQGAFQGLGELQVLALHSNGLTALPDGLLRGLGKLRQVSLRRNRLRALPRALFRNLSSLE 390

  Fly   565 AIRLDRNFLADING-VFATLVSLLWLNLSENHLVWFDYAFIPSNLKWLDIH 614
            :::||.|.|..:.| ||..|..|..:.|..|.  |.....:...|.||..|
Human   391 SVQLDHNQLETLPGDVFGALPRLTEVLLGHNS--WRCDCGLGPFLGWLRQH 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-7NP_523797.1 LRR_8 135..201 CDD:290566 127/441 (29%)
leucine-rich repeat 136..159 CDD:275380
leucine-rich repeat 160..190 CDD:275380
LRR_8 189..259 CDD:290566 18/81 (22%)
leucine-rich repeat 191..214 CDD:275380 7/29 (24%)
leucine-rich repeat 215..248 CDD:275380 6/32 (19%)
LRR_RI 247..501 CDD:238064 82/262 (31%)
LRR_8 247..308 CDD:290566 17/67 (25%)
leucine-rich repeat 249..273 CDD:275380 6/23 (26%)
leucine-rich repeat 274..297 CDD:275380 7/22 (32%)
LRR_8 297..356 CDD:290566 23/58 (40%)
leucine-rich repeat 298..321 CDD:275380 5/22 (23%)
leucine-rich repeat 322..345 CDD:275380 11/22 (50%)
LRR_8 345..406 CDD:290566 19/60 (32%)
leucine-rich repeat 346..371 CDD:275380 9/24 (38%)
leucine-rich repeat 372..395 CDD:275380 7/22 (32%)
leucine-rich repeat 396..419 CDD:275380 8/22 (36%)
LRR_8 419..478 CDD:290566 19/58 (33%)
leucine-rich repeat 420..443 CDD:275380 8/22 (36%)
leucine-rich repeat 444..467 CDD:275380 6/22 (27%)
LRR_RI 466..622 CDD:238064 44/152 (29%)
leucine-rich repeat 468..488 CDD:275380 8/20 (40%)
LRR_8 491..549 CDD:290566 14/58 (24%)
leucine-rich repeat 491..514 CDD:275380 5/23 (22%)
leucine-rich repeat 515..536 CDD:275380 5/20 (25%)
leucine-rich repeat 539..562 CDD:275380 6/22 (27%)
leucine-rich repeat 563..585 CDD:275380 10/22 (45%)
leucine-rich repeat 586..626 CDD:275380 8/29 (28%)
leucine-rich repeat 627..653 CDD:275380
LRRCT 716..772 CDD:214507
LRRNT 796..830 CDD:214470
leucine-rich repeat 812..829 CDD:275380
leucine-rich repeat 833..854 CDD:275380
LRR_8 853..913 CDD:290566
leucine-rich repeat 855..878 CDD:275380
LRR_4 878..918 CDD:289563
leucine-rich repeat 879..902 CDD:275380
leucine-rich repeat 903..926 CDD:275380
leucine-rich repeat 927..953 CDD:275380
TIR 1098..1235 CDD:214587
GP5NP_004479.1 LRR 1 75..96 4/21 (19%)
LRR_RI <76..230 CDD:238064 49/156 (31%)
LRR_8 76..134 CDD:290566 16/58 (28%)
leucine-rich repeat 76..99 CDD:275380 6/23 (26%)
LRR 2 99..120 7/20 (35%)
leucine-rich repeat 100..123 CDD:275380 7/22 (32%)
LRR 3 123..144 5/20 (25%)
leucine-rich repeat 124..147 CDD:275380 5/22 (23%)
LRR_8 147..206 CDD:290566 25/60 (42%)
LRR 4 147..168 10/20 (50%)
leucine-rich repeat 148..171 CDD:275380 11/22 (50%)
LRR_RI 163..400 CDD:238064 74/238 (31%)
LRR 5 171..193 9/23 (39%)
leucine-rich repeat 172..195 CDD:275380 9/24 (38%)
LRR_8 195..254 CDD:290566 20/58 (34%)
LRR 6 195..216 6/20 (30%)
leucine-rich repeat 196..219 CDD:275380 7/22 (32%)
LRR 7 219..240 7/20 (35%)
leucine-rich repeat 220..243 CDD:275380 8/22 (36%)
LRR_8 242..302 CDD:290566 19/59 (32%)
LRR 8 243..264 9/20 (45%)
leucine-rich repeat 244..267 CDD:275380 8/22 (36%)
LRR 9 267..288 6/20 (30%)
leucine-rich repeat 268..291 CDD:275380 6/22 (27%)
LRR 10 291..312 8/20 (40%)
leucine-rich repeat 292..315 CDD:275380 9/22 (41%)
LRR_8 314..375 CDD:290566 14/60 (23%)
leucine-rich repeat 316..338 CDD:275380 4/21 (19%)
LRR 11 340..361 5/20 (25%)
leucine-rich repeat 341..364 CDD:275380 6/22 (27%)
LRR_8 364..421 CDD:290566 18/56 (32%)
LRR 12 364..385 6/20 (30%)
leucine-rich repeat 365..388 CDD:275380 6/22 (27%)
LRR 13 388..409 9/20 (45%)
leucine-rich repeat 389..410 CDD:275380 9/20 (45%)
LRRCT 421..472 CDD:214507 6/21 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 469..498
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm8435
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.