DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-7 and Lgi1

DIOPT Version :9

Sequence 1:NP_523797.1 Gene:Toll-7 / 37272 FlyBaseID:FBgn0034476 Length:1446 Species:Drosophila melanogaster
Sequence 2:NP_665712.1 Gene:Lgi1 / 252892 RGDID:628742 Length:557 Species:Rattus norvegicus


Alignment Length:444 Identity:98/444 - (22%)
Similarity:147/444 - (33%) Gaps:154/444 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   796 CPSNCTCYHDQIWSTNVVDCGGQQTTELPRRVPMD------------------------SSVVYL 836
            ||:.|||..|.....|        ...:||.||.|                        ..::..
  Rat    42 CPAVCTCSKDNALCEN--------ARSIPRTVPPDVISLSFVRSGFTEISEGSFLFTPSLQLLLF 98

  Fly   837 DGNNFPVLKNHAFIGRKNLRALYVNGSQVAAIQNRTFASLASLQLLHLADNKLRTLHGYEFEQLS 901
            ..|:|.|:.:.||||..:|..|::..:.:.:|...||..|.||..|.||:|.|:||....|:.|.
  Rat    99 TSNSFDVISDDAFIGLPHLEYLFIENNNIKSISRHTFRGLKSLIHLSLANNNLQTLPKDIFKGLD 163

  Fly   902 ALRELYLQNNQLT-------TIE-----NATLAPLAALELIRIDGNRLVTLPIWQMHATHFGTRL 954
            :|..:.|:.|...       .:|     |||      :|.|..:|.     |.::        :.
  Rat   164 SLTNVDLRGNSFNCDCKLKWLVEWLGHTNAT------VEDIYCEGP-----PEYK--------KR 209

  Fly   955 KSISLGRNQWSCRCQFLQALTSYVADNALIVQD--------AQDIYCMAASSGTGSAALEDSSSN 1011
            |..||....:.|      .:|.:.....|..|.        ..|.|.:.|...||.....:..  
  Rat   210 KINSLSPKDFDC------IITEFAKSQDLPYQSLSIDTFSYLNDEYVVIAQPFTGKCIFLEWD-- 266

  Fly  1012 SGSLEK--RELDFNATGAA---C------TDYY------SGGSML--QHGIPESYIPLLAAALAL 1057
              .:||  |..| |.||.:   |      |..|      .|||.:  :.|....:|.:....   
  Rat   267 --HVEKTFRNYD-NITGTSTVVCKPIVIDTQLYVIVAQLFGGSHIYKRDGFANKFIKIQDIE--- 325

  Fly  1058 LFLLVVIAMVFAFR-----ESLRI---WLFAHYGVRVFGPRCEESEK-------------LYDAV 1101
                     |...|     |:.:|   |.|.          ..:|.|             .|...
  Rat   326 ---------VLKIRKPNDIETFKIEDNWYFV----------VADSSKAGFTTIYKWNGNGFYSHQ 371

  Fly  1102 LLHS-AKDSEFVCQHLAAQLETGRPPLRVCLQHRDLAHDATH---YQLLEATRV 1151
            .||: .:|::      ...||..||||.:...|..|:..:..   ||..:||::
  Rat   372 SLHAWYRDTD------VEYLEIARPPLTLRTPHLILSSSSQRPVIYQWSKATQL 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-7NP_523797.1 LRR_8 135..201 CDD:290566
leucine-rich repeat 136..159 CDD:275380
leucine-rich repeat 160..190 CDD:275380
LRR_8 189..259 CDD:290566
leucine-rich repeat 191..214 CDD:275380
leucine-rich repeat 215..248 CDD:275380
LRR_RI 247..501 CDD:238064
LRR_8 247..308 CDD:290566
leucine-rich repeat 249..273 CDD:275380
leucine-rich repeat 274..297 CDD:275380
LRR_8 297..356 CDD:290566
leucine-rich repeat 298..321 CDD:275380
leucine-rich repeat 322..345 CDD:275380
LRR_8 345..406 CDD:290566
leucine-rich repeat 346..371 CDD:275380
leucine-rich repeat 372..395 CDD:275380
leucine-rich repeat 396..419 CDD:275380
LRR_8 419..478 CDD:290566
leucine-rich repeat 420..443 CDD:275380
leucine-rich repeat 444..467 CDD:275380
LRR_RI 466..622 CDD:238064
leucine-rich repeat 468..488 CDD:275380
LRR_8 491..549 CDD:290566
leucine-rich repeat 491..514 CDD:275380
leucine-rich repeat 515..536 CDD:275380
leucine-rich repeat 539..562 CDD:275380
leucine-rich repeat 563..585 CDD:275380
leucine-rich repeat 586..626 CDD:275380
leucine-rich repeat 627..653 CDD:275380
LRRCT 716..772 CDD:214507
LRRNT 796..830 CDD:214470 11/33 (33%)
leucine-rich repeat 812..829 CDD:275380 3/16 (19%)
leucine-rich repeat 833..854 CDD:275380 7/20 (35%)
LRR_8 853..913 CDD:290566 20/59 (34%)
leucine-rich repeat 855..878 CDD:275380 6/22 (27%)
LRR_4 878..918 CDD:289563 15/51 (29%)
leucine-rich repeat 879..902 CDD:275380 10/22 (45%)
leucine-rich repeat 903..926 CDD:275380 7/34 (21%)
leucine-rich repeat 927..953 CDD:275380 4/25 (16%)
TIR 1098..1235 CDD:214587 16/58 (28%)
Lgi1NP_665712.1 leucine-rich repeat 71..92 CDD:275378 0/20 (0%)
LRR_8 91..151 CDD:404697 19/59 (32%)
LRR 1 92..113 5/20 (25%)
leucine-rich repeat 93..116 CDD:275378 7/22 (32%)
LRR 2 116..137 5/20 (25%)
leucine-rich repeat 117..140 CDD:275378 6/22 (27%)
LRR 3 140..161 10/20 (50%)
leucine-rich repeat 141..164 CDD:275378 10/22 (45%)
PCC 146..>221 CDD:188093 22/93 (24%)
leucine-rich repeat 165..177 CDD:275378 3/11 (27%)
EAR 1. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 225..267 7/45 (16%)
EPTP 225..264 CDD:397689 7/38 (18%)
EAR 2. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 271..313 11/42 (26%)
EPTP 272..310 CDD:397689 11/38 (29%)
EAR 3. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 317..364 9/68 (13%)
EPTP 317..361 CDD:397689 9/65 (14%)
EAR 4. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 366..415 14/54 (26%)
EAR 5. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 419..462 0/1 (0%)
EPTP 420..459 CDD:397689 98/444 (22%)
EAR 6. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 464..506
EPTP 464..502 CDD:397689
EAR 7. /evidence=ECO:0000255|PROSITE-ProRule:PRU00075 510..552
EPTP 510..549 CDD:397689
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.