DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-7 and Elfn1

DIOPT Version :9

Sequence 1:NP_523797.1 Gene:Toll-7 / 37272 FlyBaseID:FBgn0034476 Length:1446 Species:Drosophila melanogaster
Sequence 2:NP_001371115.1 Gene:Elfn1 / 243312 MGIID:2442479 Length:828 Species:Mus musculus


Alignment Length:121 Identity:42/121 - (34%)
Similarity:61/121 - (50%) Gaps:7/121 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   361 VDNTTFAGLIRLIVLNLAHNALTRIDYRTFKELYFLQILNLRNNSIGHIEDNAFLPLYNLHTLNL 425
            ::||       ::.|.|..|.:..:.|.:......|..|||..|.||:|||.||...:||..|.|
Mouse    58 INNT-------IVDLRLNENRIRSVQYASLSRFGNLTYLNLTKNEIGYIEDGAFSGQFNLQVLQL 115

  Fly   426 AENRLHTLDDKLFNGLYVLSKLTLNNNLISVVEPAVFKNCSDLKELDLSSNQLNEV 481
            ..|||..|.:.:..||..|..|.|..|||.||..:.|..|.::..:|||.|::.::
Mouse   116 GYNRLRNLTEGMLRGLSKLEYLYLQANLIEVVMASAFWECPNIVNIDLSMNRIQQL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-7NP_523797.1 LRR_8 135..201 CDD:290566
leucine-rich repeat 136..159 CDD:275380
leucine-rich repeat 160..190 CDD:275380
LRR_8 189..259 CDD:290566
leucine-rich repeat 191..214 CDD:275380
leucine-rich repeat 215..248 CDD:275380
LRR_RI 247..501 CDD:238064 42/121 (35%)
LRR_8 247..308 CDD:290566
leucine-rich repeat 249..273 CDD:275380
leucine-rich repeat 274..297 CDD:275380
LRR_8 297..356 CDD:290566
leucine-rich repeat 298..321 CDD:275380
leucine-rich repeat 322..345 CDD:275380
LRR_8 345..406 CDD:290566 11/44 (25%)
leucine-rich repeat 346..371 CDD:275380 2/9 (22%)
leucine-rich repeat 372..395 CDD:275380 4/22 (18%)
leucine-rich repeat 396..419 CDD:275380 12/22 (55%)
LRR_8 419..478 CDD:290566 24/58 (41%)
leucine-rich repeat 420..443 CDD:275380 9/22 (41%)
leucine-rich repeat 444..467 CDD:275380 10/22 (45%)
LRR_RI 466..622 CDD:238064 4/16 (25%)
leucine-rich repeat 468..488 CDD:275380 4/14 (29%)
LRR_8 491..549 CDD:290566
leucine-rich repeat 491..514 CDD:275380
leucine-rich repeat 515..536 CDD:275380
leucine-rich repeat 539..562 CDD:275380
leucine-rich repeat 563..585 CDD:275380
leucine-rich repeat 586..626 CDD:275380
leucine-rich repeat 627..653 CDD:275380
LRRCT 716..772 CDD:214507
LRRNT 796..830 CDD:214470
leucine-rich repeat 812..829 CDD:275380
leucine-rich repeat 833..854 CDD:275380
LRR_8 853..913 CDD:290566
leucine-rich repeat 855..878 CDD:275380
LRR_4 878..918 CDD:289563
leucine-rich repeat 879..902 CDD:275380
leucine-rich repeat 903..926 CDD:275380
leucine-rich repeat 927..953 CDD:275380
TIR 1098..1235 CDD:214587
Elfn1NP_001371115.1 LRR 1 61..82 5/27 (19%)
leucine-rich repeat 65..85 CDD:275378 4/19 (21%)
LRR_8 85..144 CDD:404697 26/58 (45%)
LRR 2 85..106 12/20 (60%)
leucine-rich repeat 86..109 CDD:275378 12/22 (55%)
LRR 3 109..130 8/20 (40%)
leucine-rich repeat 110..133 CDD:275378 9/22 (41%)
LRR_8 132..182 CDD:404697 14/40 (35%)
LRR 4 133..154 9/20 (45%)
leucine-rich repeat 134..157 CDD:275378 10/22 (45%)
LRR 5 157..178 4/15 (27%)
leucine-rich repeat 158..171 CDD:275378 4/12 (33%)
LRRCT 190..>228 CDD:214507
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 258..293
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 627..674
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 697..731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.