DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-7 and Lingo2

DIOPT Version :9

Sequence 1:NP_523797.1 Gene:Toll-7 / 37272 FlyBaseID:FBgn0034476 Length:1446 Species:Drosophila melanogaster
Sequence 2:NP_001159471.1 Gene:Lingo2 / 242384 MGIID:2442298 Length:606 Species:Mus musculus


Alignment Length:432 Identity:115/432 - (26%)
Similarity:193/432 - (44%) Gaps:58/432 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   248 ELQVLDASHNELRSISESWGISRLRRLQHLNLAYNNLSELSGEALAGLASLRIVNLSNNHLETLP 312
            |.::||.|.|.|:||:....|| ...|:.::|:.|.::.:...|...|.:||.:.|..|.|:.:|
Mouse    58 ETKILDLSKNRLKSINPEEFIS-YPLLEEIDLSDNIIANVEPGAFNNLFNLRSLRLKGNRLKLVP 121

  Fly   313 EGLFAGSKELREIHLQQNELYELPKGLFHRLEQLLVVDLSGNQLTSNHVDNTTFAGLIRLIVLNL 377
            .|:|.|...|.::.:.:|::..|...:|..|..|..:::..|.|.  ::.:..|:||:.|..|.|
Mouse   122 LGVFTGLSNLTKLDISENKIVILLDYMFQDLHNLKSLEVGDNDLV--YISHRAFSGLLSLEQLTL 184

  Fly   378 AHNALTRIDYRTFKELYFLQILNLRNNSIGHIEDNAFLPLYNLHTLNLAENRLHTLDDKLFNGLY 442
            ....||.:.......|..|..|:|::.:|.::...||..|:  |..||..:....||....|.||
Mouse   185 EKCNLTAVPTEALSHLRSLIALHLKHLNINNMPVYAFKRLF--HLKNLEIDYWPLLDLMPANSLY 247

  Fly   443 VLSKLTLNNNLISVVEPAVFKNCSDLKELDLSSNQLNEVP-RALQDLAMLRTLDLGENQIRTFDN 506
            .|                      :|..|.:::..|:.|| .|.:.|..|..|:|..|.|.|.:.
Mouse   248 GL----------------------NLTSLSITNTNLSTVPFLAFKHLVYLTHLNLSYNPISTIEA 290

  Fly   507 QSFKNLHQLTGLRLIDNQIGNITVGMFQDLPRLSVLNLAKNRIQSIERGSFDKNFELEAIRLDRN 571
            ..|.:|.:|..|.::..|:..|....||.|..|.|||:::|.::::|...|.....||.:.::.|
Mouse   291 GMFSDLIRLQELHIVGAQLRTIEPHSFQGLRFLRVLNVSQNLLETLEENVFSSPRALEVLSINNN 355

  Fly   572 FLA-DINGVFATLVSLLWLNLSENHLVWFDYAFI---PSNLK---WLDIHGNYIEALGNYYKLQE 629
            .|| |..        ||||...:.:|.:.....:   |..::   :.|.|..   ||..|:..::
Mouse   356 PLACDCR--------LLWLLQRQPNLQFGGQQPMCAGPDTIRERSFKDFHST---ALSFYFTCK
K 409

  Fly   630 -EIRVKTLDASHNRITEIGPMSIPNTIELLFINNNLIGNVQP 670
             :||.|.|  .|..:.|      ..|::|   ..|..|:.||
Mouse   410 PKIREKKL--QHLLVDE------GQTVQL---ECNADGDPQP 440

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-7NP_523797.1 LRR_8 135..201 CDD:290566
leucine-rich repeat 136..159 CDD:275380
leucine-rich repeat 160..190 CDD:275380
LRR_8 189..259 CDD:290566 5/10 (50%)
leucine-rich repeat 191..214 CDD:275380
leucine-rich repeat 215..248 CDD:275380 115/432 (27%)
LRR_RI 247..501 CDD:238064 68/253 (27%)
LRR_8 247..308 CDD:290566 19/59 (32%)
leucine-rich repeat 249..273 CDD:275380 9/23 (39%)
leucine-rich repeat 274..297 CDD:275380 5/22 (23%)
LRR_8 297..356 CDD:290566 16/58 (28%)
leucine-rich repeat 298..321 CDD:275380 9/22 (41%)
leucine-rich repeat 322..345 CDD:275380 5/22 (23%)
LRR_8 345..406 CDD:290566 15/60 (25%)
leucine-rich repeat 346..371 CDD:275380 6/24 (25%)
leucine-rich repeat 372..395 CDD:275380 6/22 (27%)
leucine-rich repeat 396..419 CDD:275380 7/22 (32%)
LRR_8 419..478 CDD:290566 11/58 (19%)
leucine-rich repeat 420..443 CDD:275380 7/22 (32%)
leucine-rich repeat 444..467 CDD:275380 1/22 (5%)
LRR_RI 466..622 CDD:238064 44/163 (27%)
leucine-rich repeat 468..488 CDD:275380 6/20 (30%)
LRR_8 491..549 CDD:290566 20/57 (35%)
leucine-rich repeat 491..514 CDD:275380 8/22 (36%)
leucine-rich repeat 515..536 CDD:275380 6/20 (30%)
leucine-rich repeat 539..562 CDD:275380 7/22 (32%)
leucine-rich repeat 563..585 CDD:275380 6/22 (27%)
leucine-rich repeat 586..626 CDD:275380 11/45 (24%)
leucine-rich repeat 627..653 CDD:275380 6/26 (23%)
LRRCT 716..772 CDD:214507
LRRNT 796..830 CDD:214470
leucine-rich repeat 812..829 CDD:275380
leucine-rich repeat 833..854 CDD:275380
LRR_8 853..913 CDD:290566
leucine-rich repeat 855..878 CDD:275380
LRR_4 878..918 CDD:289563
leucine-rich repeat 879..902 CDD:275380
leucine-rich repeat 903..926 CDD:275380
leucine-rich repeat 927..953 CDD:275380
TIR 1098..1235 CDD:214587
Lingo2NP_001159471.1 LRRNT 27..60 CDD:214470 1/1 (100%)
leucine-rich repeat 39..57 CDD:275380
LRR 1 58..79 8/20 (40%)
leucine-rich repeat 59..82 CDD:275380 9/23 (39%)
LRR_8 60..117 CDD:404697 18/57 (32%)
LRR 2 82..103 4/20 (20%)
leucine-rich repeat 83..106 CDD:275380 5/22 (23%)
LRR_8 106..165 CDD:404697 16/58 (28%)
LRR 3 106..127 8/20 (40%)
leucine-rich repeat 107..130 CDD:275380 9/22 (41%)
LRR 4 130..151 4/20 (20%)
leucine-rich repeat 131..154 CDD:275380 5/22 (23%)
LRR 5 154..175 4/22 (18%)
leucine-rich repeat 155..178 CDD:275380 6/24 (25%)
PPP1R42 176..>373 CDD:411060 62/228 (27%)
LRR 6 178..199 5/20 (25%)
leucine-rich repeat 179..202 CDD:275380 6/22 (27%)
LRR 7 202..223 6/20 (30%)
leucine-rich repeat 203..250 CDD:275380 16/70 (23%)
LRR 8 226..247 6/20 (30%)
LRR 9 250..271 6/20 (30%)
leucine-rich repeat 251..274 CDD:275380 7/22 (32%)
LRR 10 274..295 7/20 (35%)
leucine-rich repeat 275..298 CDD:275380 8/22 (36%)
LRR 11 298..319 5/20 (25%)
leucine-rich repeat 299..322 CDD:275380 7/22 (32%)
LRR 12 322..343 7/20 (35%)
leucine-rich repeat 323..343 CDD:275380 7/19 (37%)
LRRCT 355..408 CDD:214507 15/63 (24%)
Ig 411..500 CDD:416386 12/41 (29%)
Ig strand A' 417..421 CDD:409353 2/5 (40%)
Ig strand B 427..436 CDD:409353 3/11 (27%)
Ig strand C 441..446 CDD:409353 115/432 (27%)
Ig strand C' 449..451 CDD:409353
Ig strand D 460..463 CDD:409353
Ig strand E 466..473 CDD:409353
Ig strand F 479..487 CDD:409353
Ig strand G 490..500 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.