Sequence 1: | NP_523797.1 | Gene: | Toll-7 / 37272 | FlyBaseID: | FBgn0034476 | Length: | 1446 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001159471.1 | Gene: | Lingo2 / 242384 | MGIID: | 2442298 | Length: | 606 | Species: | Mus musculus |
Alignment Length: | 432 | Identity: | 115/432 - (26%) |
---|---|---|---|
Similarity: | 193/432 - (44%) | Gaps: | 58/432 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 248 ELQVLDASHNELRSISESWGISRLRRLQHLNLAYNNLSELSGEALAGLASLRIVNLSNNHLETLP 312
Fly 313 EGLFAGSKELREIHLQQNELYELPKGLFHRLEQLLVVDLSGNQLTSNHVDNTTFAGLIRLIVLNL 377
Fly 378 AHNALTRIDYRTFKELYFLQILNLRNNSIGHIEDNAFLPLYNLHTLNLAENRLHTLDDKLFNGLY 442
Fly 443 VLSKLTLNNNLISVVEPAVFKNCSDLKELDLSSNQLNEVP-RALQDLAMLRTLDLGENQIRTFDN 506
Fly 507 QSFKNLHQLTGLRLIDNQIGNITVGMFQDLPRLSVLNLAKNRIQSIERGSFDKNFELEAIRLDRN 571
Fly 572 FLA-DINGVFATLVSLLWLNLSENHLVWFDYAFI---PSNLK---WLDIHGNYIEALGNYYKLQE 629
Fly 630 -EIRVKTLDASHNRITEIGPMSIPNTIELLFINNNLIGNVQP 670 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Toll-7 | NP_523797.1 | LRR_8 | 135..201 | CDD:290566 | |
leucine-rich repeat | 136..159 | CDD:275380 | |||
leucine-rich repeat | 160..190 | CDD:275380 | |||
LRR_8 | 189..259 | CDD:290566 | 5/10 (50%) | ||
leucine-rich repeat | 191..214 | CDD:275380 | |||
leucine-rich repeat | 215..248 | CDD:275380 | 115/432 (27%) | ||
LRR_RI | 247..501 | CDD:238064 | 68/253 (27%) | ||
LRR_8 | 247..308 | CDD:290566 | 19/59 (32%) | ||
leucine-rich repeat | 249..273 | CDD:275380 | 9/23 (39%) | ||
leucine-rich repeat | 274..297 | CDD:275380 | 5/22 (23%) | ||
LRR_8 | 297..356 | CDD:290566 | 16/58 (28%) | ||
leucine-rich repeat | 298..321 | CDD:275380 | 9/22 (41%) | ||
leucine-rich repeat | 322..345 | CDD:275380 | 5/22 (23%) | ||
LRR_8 | 345..406 | CDD:290566 | 15/60 (25%) | ||
leucine-rich repeat | 346..371 | CDD:275380 | 6/24 (25%) | ||
leucine-rich repeat | 372..395 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 396..419 | CDD:275380 | 7/22 (32%) | ||
LRR_8 | 419..478 | CDD:290566 | 11/58 (19%) | ||
leucine-rich repeat | 420..443 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 444..467 | CDD:275380 | 1/22 (5%) | ||
LRR_RI | 466..622 | CDD:238064 | 44/163 (27%) | ||
leucine-rich repeat | 468..488 | CDD:275380 | 6/20 (30%) | ||
LRR_8 | 491..549 | CDD:290566 | 20/57 (35%) | ||
leucine-rich repeat | 491..514 | CDD:275380 | 8/22 (36%) | ||
leucine-rich repeat | 515..536 | CDD:275380 | 6/20 (30%) | ||
leucine-rich repeat | 539..562 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 563..585 | CDD:275380 | 6/22 (27%) | ||
leucine-rich repeat | 586..626 | CDD:275380 | 11/45 (24%) | ||
leucine-rich repeat | 627..653 | CDD:275380 | 6/26 (23%) | ||
LRRCT | 716..772 | CDD:214507 | |||
LRRNT | 796..830 | CDD:214470 | |||
leucine-rich repeat | 812..829 | CDD:275380 | |||
leucine-rich repeat | 833..854 | CDD:275380 | |||
LRR_8 | 853..913 | CDD:290566 | |||
leucine-rich repeat | 855..878 | CDD:275380 | |||
LRR_4 | 878..918 | CDD:289563 | |||
leucine-rich repeat | 879..902 | CDD:275380 | |||
leucine-rich repeat | 903..926 | CDD:275380 | |||
leucine-rich repeat | 927..953 | CDD:275380 | |||
TIR | 1098..1235 | CDD:214587 | |||
Lingo2 | NP_001159471.1 | LRRNT | 27..60 | CDD:214470 | 1/1 (100%) |
leucine-rich repeat | 39..57 | CDD:275380 | |||
LRR 1 | 58..79 | 8/20 (40%) | |||
leucine-rich repeat | 59..82 | CDD:275380 | 9/23 (39%) | ||
LRR_8 | 60..117 | CDD:404697 | 18/57 (32%) | ||
LRR 2 | 82..103 | 4/20 (20%) | |||
leucine-rich repeat | 83..106 | CDD:275380 | 5/22 (23%) | ||
LRR_8 | 106..165 | CDD:404697 | 16/58 (28%) | ||
LRR 3 | 106..127 | 8/20 (40%) | |||
leucine-rich repeat | 107..130 | CDD:275380 | 9/22 (41%) | ||
LRR 4 | 130..151 | 4/20 (20%) | |||
leucine-rich repeat | 131..154 | CDD:275380 | 5/22 (23%) | ||
LRR 5 | 154..175 | 4/22 (18%) | |||
leucine-rich repeat | 155..178 | CDD:275380 | 6/24 (25%) | ||
PPP1R42 | 176..>373 | CDD:411060 | 62/228 (27%) | ||
LRR 6 | 178..199 | 5/20 (25%) | |||
leucine-rich repeat | 179..202 | CDD:275380 | 6/22 (27%) | ||
LRR 7 | 202..223 | 6/20 (30%) | |||
leucine-rich repeat | 203..250 | CDD:275380 | 16/70 (23%) | ||
LRR 8 | 226..247 | 6/20 (30%) | |||
LRR 9 | 250..271 | 6/20 (30%) | |||
leucine-rich repeat | 251..274 | CDD:275380 | 7/22 (32%) | ||
LRR 10 | 274..295 | 7/20 (35%) | |||
leucine-rich repeat | 275..298 | CDD:275380 | 8/22 (36%) | ||
LRR 11 | 298..319 | 5/20 (25%) | |||
leucine-rich repeat | 299..322 | CDD:275380 | 7/22 (32%) | ||
LRR 12 | 322..343 | 7/20 (35%) | |||
leucine-rich repeat | 323..343 | CDD:275380 | 7/19 (37%) | ||
LRRCT | 355..408 | CDD:214507 | 15/63 (24%) | ||
Ig | 411..500 | CDD:416386 | 12/41 (29%) | ||
Ig strand A' | 417..421 | CDD:409353 | 2/5 (40%) | ||
Ig strand B | 427..436 | CDD:409353 | 3/11 (27%) | ||
Ig strand C | 441..446 | CDD:409353 | 115/432 (27%) | ||
Ig strand C' | 449..451 | CDD:409353 | |||
Ig strand D | 460..463 | CDD:409353 | |||
Ig strand E | 466..473 | CDD:409353 | |||
Ig strand F | 479..487 | CDD:409353 | |||
Ig strand G | 490..500 | CDD:409353 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24373 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |