DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Toll-7 and LGI3

DIOPT Version :9

Sequence 1:	NP_523797.1	Gene:	Toll-7 / 37272	FlyBaseID:	FBgn0034476	Length:	1446	Species:	Drosophila melanogaster
Sequence 2:	NP_644807.1	Gene:	LGI3 / 203190	HGNCID:	18711	Length:	548	Species:	Homo sapiens

Alignment Length:	185	Identity:	48/185 - (25%)
Similarity:	78/185 - (42%)	Gaps:	48/185 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly   796 CPSNCTCYHDQIWSTNVVDCGGQQTTELPRRVPMDSSVVYL-----------DG----------- 838
            ||.:|:|..|..:..:        :..:||.:|  |.|:.|           ||
Human    39 CPPSCSCTRDTAFCVD--------SKAVPRNLP--SEVISLTLVNAAFSEIQDGAFSHLPLLQFL 93

  Fly   839 ----NNFPVLKNHAFIGRKNLRALYVNGSQVAAIQNRTFASLASLQLLHLADNKLRTLHGYEFEQ 899
                |.|.::.::||.|..:|:.|::..:.:.|:...||..|.||..|.||:|.|:||....|..
Human    94 LLNSNKFTLIGDNAFTGLSHLQYLFIENNDIWALSKFTFRGLKSLTHLSLANNNLQTLPRDIFRP 158

  Fly   900 LSALRELYLQNNQLT-------TIE-----NATLAPLAALELIRIDGNRLVTLPI 942
            |..|.:|.|:.|.|.       .:|     |.|:||:......|...:::..||:
Human   159 LDILNDLDLRGNSLNCDCKVKWLVEWLAHTNTTVAPIYCASPPRFQEHKVQDLPL 213

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Toll-7	NP_523797.1	LRR_8	135..201	CDD:290566
		leucine-rich repeat	136..159	CDD:275380
		leucine-rich repeat	160..190	CDD:275380
		LRR_8	189..259	CDD:290566
		leucine-rich repeat	191..214	CDD:275380
		leucine-rich repeat	215..248	CDD:275380
		LRR_RI	247..501	CDD:238064
		LRR_8	247..308	CDD:290566
		leucine-rich repeat	249..273	CDD:275380
		leucine-rich repeat	274..297	CDD:275380
		LRR_8	297..356	CDD:290566
		leucine-rich repeat	298..321	CDD:275380
		leucine-rich repeat	322..345	CDD:275380
		LRR_8	345..406	CDD:290566
		leucine-rich repeat	346..371	CDD:275380
		leucine-rich repeat	372..395	CDD:275380
		leucine-rich repeat	396..419	CDD:275380
		LRR_8	419..478	CDD:290566
		leucine-rich repeat	420..443	CDD:275380
		leucine-rich repeat	444..467	CDD:275380
		LRR_RI	466..622	CDD:238064
		leucine-rich repeat	468..488	CDD:275380
		LRR_8	491..549	CDD:290566
		leucine-rich repeat	491..514	CDD:275380
		leucine-rich repeat	515..536	CDD:275380
		leucine-rich repeat	539..562	CDD:275380
		leucine-rich repeat	563..585	CDD:275380
		leucine-rich repeat	586..626	CDD:275380
		leucine-rich repeat	627..653	CDD:275380
		LRRCT	716..772	CDD:214507
		LRRNT	796..830	CDD:214470	8/33 (24%)
		leucine-rich repeat	812..829	CDD:275380	2/16 (13%)
		leucine-rich repeat	833..854	CDD:275380	9/46 (20%)
		LRR_8	853..913	CDD:290566	21/59 (36%)
		leucine-rich repeat	855..878	CDD:275380	6/22 (27%)
		LRR_4	878..918	CDD:289563	17/51 (33%)
		leucine-rich repeat	879..902	CDD:275380	10/22 (45%)
		leucine-rich repeat	903..926	CDD:275380	10/34 (29%)
		leucine-rich repeat	927..953	CDD:275380	3/16 (19%)
		TIR	1098..1235	CDD:214587
LGI3	NP_644807.1	LRR_8	68..124	CDD:290566	10/55 (18%)
		leucine-rich repeat	68..89	CDD:275378	3/20 (15%)
		LRR 1	89..110		4/20 (20%)
		leucine-rich repeat	90..113	CDD:275378	5/22 (23%)
		LRR_8	112..172	CDD:290566	21/59 (36%)
		LRR_4	113..152	CDD:289563	14/38 (37%)
		LRR 2	113..134		5/20 (25%)
		leucine-rich repeat	114..137	CDD:275378	6/22 (27%)
		LRR	135..158	CDD:197688	11/22 (50%)
		LRR 3	137..158		10/20 (50%)
		leucine-rich repeat	138..161	CDD:275378	10/22 (45%)
		leucine-rich repeat	162..174	CDD:275378	5/11 (45%)
		LRRCT	170..218	CDD:214507	10/44 (23%)
		EAR 1. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00075	222..264
		EPTP	222..263	CDD:281697
		EAR 2. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00075	268..310
		EPTP	268..309	CDD:281697
		EAR 3. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00075	314..361
		EPTP	314..359	CDD:281697
		EAR 4. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00075	363..406
		EPTP	363..405	CDD:281697
		EAR 5. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00075	410..453
		EPTP	410..452	CDD:281697
		EAR 6. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00075	455..497
		EPTP	455..496	CDD:281697
		EAR 7. /evidence=ECO:0000255\|PROSITE-ProRule:PRU00075	501..543
		EPTP	501..541	CDD:281697
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	0	0.000