DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Toll-7 and Lrrc3c

DIOPT Version :9

Sequence 1:	NP_523797.1	Gene:	Toll-7 / 37272	FlyBaseID:	FBgn0034476	Length:	1446	Species:	Drosophila melanogaster
Sequence 2:	NP_001182473.1	Gene:	Lrrc3c / 192852	MGIID:	2684858	Length:	255	Species:	Mus musculus

Alignment Length:	242	Identity:	58/242 - (23%)
Similarity:	84/242 - (34%)	Gaps:	89/242 - (36%)

- Green bases have known domain annotations that are detailed below.

  Fly   802 CYHDQIWSTNVVDCGGQQT--------TELPRRVPMDSSVVYLDGNNFPVLKNHAFIGRKNLRAL 858
            ||        |.:..|:||        :.:|..:|.|:..:|||.|
Mouse    31 CY--------VAEEAGEQTFRCSRAGLSAVPNGIPNDTRKLYLDAN------------------- 68

  Fly   859 YVNGSQVAAIQNRTFASLASLQLLHLADNKLRTLHGYEFEQL-SALRELYLQNNQLTTIENATLA 922
                 |:|::....|..|.:|:.|.|:.|.|..|.|..|:.| ..||.|.|..|||.::
Mouse    69 -----QLASVPAGAFQHLPALEELDLSHNALVHLSGAAFQGLEGTLRHLDLSANQLASV------ 122

  Fly   923 PLAALELIRIDGNRLVTLPIWQMHATHFGTRLKSISLGRNQWSCRCQFLQALTSYVADNALIVQD 987
            |:||...::|                       .::|..|.|.|.|. ||.:..:|.
Mouse   123 PVAAFVGLQI-----------------------QVNLSANPWRCDCA-LQEVLRHVR-------- 155

  Fly   988 AQDIYCMAASSGT----GSAALEDSSSNSGSLEKRELDFNATGAACT 1030
                  :|..|||    |..|..|...:...|..||.:...||...|
Mouse   156 ------LAPGSGTGIVCGPEARPDLVGHEFLLLTREEELCGTGRGGT 196

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Toll-7	NP_523797.1	LRR_8	135..201	CDD:290566
		leucine-rich repeat	136..159	CDD:275380
		leucine-rich repeat	160..190	CDD:275380
		LRR_8	189..259	CDD:290566
		leucine-rich repeat	191..214	CDD:275380
		leucine-rich repeat	215..248	CDD:275380
		LRR_RI	247..501	CDD:238064
		LRR_8	247..308	CDD:290566
		leucine-rich repeat	249..273	CDD:275380
		leucine-rich repeat	274..297	CDD:275380
		LRR_8	297..356	CDD:290566
		leucine-rich repeat	298..321	CDD:275380
		leucine-rich repeat	322..345	CDD:275380
		LRR_8	345..406	CDD:290566
		leucine-rich repeat	346..371	CDD:275380
		leucine-rich repeat	372..395	CDD:275380
		leucine-rich repeat	396..419	CDD:275380
		LRR_8	419..478	CDD:290566
		leucine-rich repeat	420..443	CDD:275380
		leucine-rich repeat	444..467	CDD:275380
		LRR_RI	466..622	CDD:238064
		leucine-rich repeat	468..488	CDD:275380
		LRR_8	491..549	CDD:290566
		leucine-rich repeat	491..514	CDD:275380
		leucine-rich repeat	515..536	CDD:275380
		leucine-rich repeat	539..562	CDD:275380
		leucine-rich repeat	563..585	CDD:275380
		leucine-rich repeat	586..626	CDD:275380
		leucine-rich repeat	627..653	CDD:275380
		LRRCT	716..772	CDD:214507
		LRRNT	796..830	CDD:214470	8/35 (23%)
		leucine-rich repeat	812..829	CDD:275380	5/24 (21%)
		leucine-rich repeat	833..854	CDD:275380	4/20 (20%)
		LRR_8	853..913	CDD:290566	18/60 (30%)
		leucine-rich repeat	855..878	CDD:275380	4/22 (18%)
		LRR_4	878..918	CDD:289563	16/40 (40%)
		leucine-rich repeat	879..902	CDD:275380	9/23 (39%)
		leucine-rich repeat	903..926	CDD:275380	8/22 (36%)
		leucine-rich repeat	927..953	CDD:275380	1/25 (4%)
		TIR	1098..1235	CDD:214587
Lrrc3c	NP_001182473.1	leucine-rich repeat	40..59	CDD:275378	4/18 (22%)
		leucine-rich repeat	60..83	CDD:275378	8/46 (17%)
		LRR_8	61..119	CDD:290566	22/81 (27%)
		LRR_4	61..99	CDD:289563	14/61 (23%)
		LRR_4	82..123	CDD:289563	16/46 (35%)
		leucine-rich repeat	84..108	CDD:275378	9/23 (39%)
		leucine-rich repeat	109..131	CDD:275378	10/27 (37%)
		leucine-rich repeat	132..143	CDD:275378	4/33 (12%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR24373
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	2.010