DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-7 and Lrrn3

DIOPT Version :9

Sequence 1:NP_523797.1 Gene:Toll-7 / 37272 FlyBaseID:FBgn0034476 Length:1446 Species:Drosophila melanogaster
Sequence 2:NP_001258637.1 Gene:Lrrn3 / 16981 MGIID:106036 Length:707 Species:Mus musculus


Alignment Length:423 Identity:113/423 - (26%)
Similarity:176/423 - (41%) Gaps:85/423 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   397 QILNLRNNSIGHIEDNAFLPLYNLHTLNLAENRLHTLDDKLFNGLYVLSKLTLNNNLISVVEPAV 461
            |||.|:.|:|..||.:...|: ||..|:|::                       |||.||....|
Mouse    72 QILLLQTNNIARIEHSTDFPV-NLTGLDLSQ-----------------------NNLSSVTNINV 112

  Fly   462 FKNCSDLKELDLSSNQLNEVP-RALQDLAMLRTLDLGENQIRTFDNQSFKNLHQLTGLRLIDNQI 525
            .| .|.|..:.|..|:|.|:| :.|..|:.|:.|.:..|.:.|....:|..||.|..|.|..|::
Mouse   113 QK-MSQLLSVYLEENKLTELPEKCLYGLSNLQELYVNHNLLSTISPGAFIGLHNLLRLHLNSNRL 176

  Fly   526 GNITVGMFQDLPRLSVLNLAKNRIQSIERGSFDKNFELEAIRLDRNFLADIN------GVFATLV 584
            ..|....|..||.|.:|.|..|.|..|:    |.||: ..::|....:|.||      ...|.|.
Mouse   177 QMINSQWFDALPNLEILMLGDNPIIRIK----DMNFQ-PLVKLRSLVIAGINLTEIPDDALAGLE 236

  Fly   585 SLLWLNLSENHLVWFDYAFIPS-------NLKWLDIHGNYIEAL--GNYYKLQEEIRVKTLDASH 640
            :|..::..:|.|     :.:|.       |||:||::.|.|..:  |::..:   :.:|.|..::
Mouse   237 NLESISFYDNRL-----SKVPQVALQKAVNLKFLDLNKNPINRIRRGDFSNM---LHLKELGINN 293

  Fly   641 -NRITEIGPMSIPNTIELLFI---NNNLIGNVQPNAFVDKANLARVDLYANQLSKLQLQQLRVAP 701
             ..:..|..:::.|..:|..|   ||..:..:.||||.....|..:.|..|.||.|....:...|
Mouse   294 MPELVSIDSLAVDNLPDLRKIEATNNPRLSYIHPNAFFRLPKLESLMLNTNALSALYHGTIESLP 358

  Fly   702 VVAPKPLPEFYLGGNPFECDCTMDWLQRINNLTTRQHPRVMDMANIECV-MPHARGAAVR----- 760
                 .|.|..:..||..|||.:.|:.     ..:.:.|.|:..::.|| .|..:|..||     
Mouse   359 -----NLKEISIHSNPIRCDCVIRWIN-----MNKTNIRFMEPDSLFCVDPPEFQGQNVRQVHFR 413

  Fly   761 -------PLSGLRPQDFL--CRYESHCFALCHC 784
                   ||  :.|:.|.  ...|:..:...||
Mouse   414 DMMEICLPL--IAPESFPSDLDVEADSYVSLHC 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-7NP_523797.1 LRR_8 135..201 CDD:290566
leucine-rich repeat 136..159 CDD:275380
leucine-rich repeat 160..190 CDD:275380
LRR_8 189..259 CDD:290566
leucine-rich repeat 191..214 CDD:275380
leucine-rich repeat 215..248 CDD:275380
LRR_RI 247..501 CDD:238064 32/104 (31%)
LRR_8 247..308 CDD:290566
leucine-rich repeat 249..273 CDD:275380
leucine-rich repeat 274..297 CDD:275380
LRR_8 297..356 CDD:290566
leucine-rich repeat 298..321 CDD:275380
leucine-rich repeat 322..345 CDD:275380
LRR_8 345..406 CDD:290566 5/8 (63%)
leucine-rich repeat 346..371 CDD:275380
leucine-rich repeat 372..395 CDD:275380
leucine-rich repeat 396..419 CDD:275380 9/21 (43%)
LRR_8 419..478 CDD:290566 15/58 (26%)
leucine-rich repeat 420..443 CDD:275380 3/22 (14%)
leucine-rich repeat 444..467 CDD:275380 7/22 (32%)
LRR_RI 466..622 CDD:238064 50/171 (29%)
leucine-rich repeat 468..488 CDD:275380 7/20 (35%)
LRR_8 491..549 CDD:290566 19/57 (33%)
leucine-rich repeat 491..514 CDD:275380 6/22 (27%)
leucine-rich repeat 515..536 CDD:275380 6/20 (30%)
leucine-rich repeat 539..562 CDD:275380 8/22 (36%)
leucine-rich repeat 563..585 CDD:275380 6/27 (22%)
leucine-rich repeat 586..626 CDD:275380 12/48 (25%)
leucine-rich repeat 627..653 CDD:275380 3/26 (12%)
LRRCT 716..772 CDD:214507 18/70 (26%)
LRRNT 796..830 CDD:214470
leucine-rich repeat 812..829 CDD:275380
leucine-rich repeat 833..854 CDD:275380
LRR_8 853..913 CDD:290566
leucine-rich repeat 855..878 CDD:275380
LRR_4 878..918 CDD:289563
leucine-rich repeat 879..902 CDD:275380
leucine-rich repeat 903..926 CDD:275380
leucine-rich repeat 927..953 CDD:275380
TIR 1098..1235 CDD:214587
Lrrn3NP_001258637.1 LRRNT 28..72 CDD:214470 113/423 (27%)
LRR 1 70..91 8/18 (44%)
leucine-rich repeat 72..93 CDD:275380 9/21 (43%)
LRR_8 93..152 CDD:290566 23/82 (28%)
LRR 2 93..114 10/43 (23%)
leucine-rich repeat 94..117 CDD:275380 10/46 (22%)
LRR 3 117..138 7/20 (35%)
leucine-rich repeat 118..141 CDD:275380 8/22 (36%)
LRR 139..160 CDD:197688 5/20 (25%)
LRR 4 141..162 5/20 (25%)
leucine-rich repeat 142..165 CDD:275380 6/22 (27%)
LRR 5 165..186 6/20 (30%)
leucine-rich repeat 166..189 CDD:275380 7/22 (32%)
LRR_8 173..221 CDD:290566 15/52 (29%)
LRR 6 189..210 9/25 (36%)
leucine-rich repeat 190..213 CDD:275380 9/27 (33%)
LRR_8 213..272 CDD:290566 16/63 (25%)
LRR 7 213..234 4/20 (20%)
leucine-rich repeat 214..237 CDD:275380 6/22 (27%)
LRR 8 237..258 4/25 (16%)
leucine-rich repeat 238..261 CDD:275380 4/27 (15%)
LRR 9 261..282 8/20 (40%)
leucine-rich repeat 262..285 CDD:275380 7/25 (28%)
LRR 10 285..304 3/18 (17%)
leucine-rich repeat 286..310 CDD:275380 4/23 (17%)
LRR 11 310..332 8/21 (38%)
LRR_8 311..370 CDD:290566 18/63 (29%)
leucine-rich repeat 311..333 CDD:275380 8/21 (38%)
LRR 12 335..358 6/22 (27%)
leucine-rich repeat 336..359 CDD:275380 7/27 (26%)
LRRCT 368..419 CDD:214507 14/55 (25%)
I-set 429..513 CDD:254352 3/16 (19%)
Ig 440..513 CDD:299845 2/5 (40%)
fn3 526..593 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.