DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Toll-7 and LRRN2

DIOPT Version :9

Sequence 1:NP_523797.1 Gene:Toll-7 / 37272 FlyBaseID:FBgn0034476 Length:1446 Species:Drosophila melanogaster
Sequence 2:NP_006329.2 Gene:LRRN2 / 10446 HGNCID:16914 Length:713 Species:Homo sapiens


Alignment Length:514 Identity:116/514 - (22%)
Similarity:190/514 - (36%) Gaps:150/514 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 VNLSNNHLETLPEGLFAGSKELREIHLQQNELYELPKGLFHRLEQLLVVDLSGNQLTSNHVDNTT 365
            |:.::..|..:|..|.||::.|.   ||.|.:..:.:.....|..|..:|||.|..:.  ..:..
Human    53 VDCNDLFLTAVPPALPAGTQTLL---LQSNSIVRVDQSELGYLANLTELDLSQNSFSD--ARDCD 112

  Fly   366 FAGLIRLIVLNLAHNALTRIDYRTFKELYFLQILNLRNNSIGHIEDNAFLPLYNLHTLNLAENRL 430
            |..|.:|:.|:|..|.|||                        :||::|..|.:|..|.|..|:|
Human   113 FHALPQLLSLHLEENQLTR------------------------LEDHSFAGLASLQELYLNHNQL 153

  Fly   431 HTLDDKLFNGLYVLSKLTLNNNLISVVEPAVFKNCSDLKELDLSSNQLNEV-PRALQDLAMLRTL 494
            :.:..:.|:||..|.:|.||:||:..::...|:...:|:.|.:..|:::.: ....:.||.||:|
Human   154 YRIAPRAFSGLSNLLRLHLNSNLLRAIDSRWFEMLPNLEILMIGGNKVDAILDMNFRPLANLRSL 218

  Fly   495 DLGENQIRTFDNQSFKNLHQLTGLRLIDNQIGNITVGMFQDLPRLSVLNLAKNRIQSIERGSFDK 559
            .|....:|...:.:.:.|..|..|...|||:..:.....:.:|.|..|:|.||.:|.:..|.|..
Human   219 VLAGMNLREISDYALEGLQSLESLSFYDNQLARVPRRALEQVPGLKFLDLNKNPLQRVGPGDFAN 283

  Fly   560 NFELEAIRLDRNFLADINGVFATLVSLLWLNLSENHLVWFD-YAFIPSNLKWLDIHGNYIEALGN 623
            ...|:.:.|:                    |:.|  ||..| :|.:                   
Human   284 MLHLKELGLN--------------------NMEE--LVSIDKFALV------------------- 307

  Fly   624 YYKLQEEIRVKTLDASHNRITEIGPMSIPNTIELLFINNNLIGNVQPNAFVDKANLARVDLYANQ 688
                                      ::|...:|...||..:..:.|.||.....:..:.|..|.
Human   308 --------------------------NLPELTKLDITNNPRLSFIHPRAFHHLPQMETLMLNNNA 346

  Fly   689 LSKLQLQQLRVAPVVAPKPLPEFYLGGNPFECDCTMDW-----------------------LQR- 729
            ||.|..|.:...|     .|.|..|.|||..|||.:.|                       ||| 
Human   347 LSALHQQTVESLP-----NLQEVGLHGNPIRCDCVIRWANATGTRVRFIEPQSTLCAEPPDLQRL 406

  Fly   730 --------------INNLTTRQHPRVMDMANIECVMPHARGAA--------VRPLSGLR 766
                          :..::.|..|..:.:|:.|.::.|.|..|        |.| :|||
Human   407 PVREVPFREMTDHCLPLISPRSFPPSLQVASGESMVLHCRALAEPEPEIYWVTP-AGLR 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Toll-7NP_523797.1 LRR_8 135..201 CDD:290566
leucine-rich repeat 136..159 CDD:275380
leucine-rich repeat 160..190 CDD:275380
LRR_8 189..259 CDD:290566
leucine-rich repeat 191..214 CDD:275380
leucine-rich repeat 215..248 CDD:275380
LRR_RI 247..501 CDD:238064 53/200 (27%)
LRR_8 247..308 CDD:290566 1/6 (17%)
leucine-rich repeat 249..273 CDD:275380
leucine-rich repeat 274..297 CDD:275380
LRR_8 297..356 CDD:290566 16/54 (30%)
leucine-rich repeat 298..321 CDD:275380 6/19 (32%)
leucine-rich repeat 322..345 CDD:275380 5/22 (23%)
LRR_8 345..406 CDD:290566 14/60 (23%)
leucine-rich repeat 346..371 CDD:275380 7/24 (29%)
leucine-rich repeat 372..395 CDD:275380 7/22 (32%)
leucine-rich repeat 396..419 CDD:275380 4/22 (18%)
LRR_8 419..478 CDD:290566 18/58 (31%)
leucine-rich repeat 420..443 CDD:275380 8/22 (36%)
leucine-rich repeat 444..467 CDD:275380 7/22 (32%)
LRR_RI 466..622 CDD:238064 33/157 (21%)
leucine-rich repeat 468..488 CDD:275380 3/20 (15%)
LRR_8 491..549 CDD:290566 17/57 (30%)
leucine-rich repeat 491..514 CDD:275380 6/22 (27%)
leucine-rich repeat 515..536 CDD:275380 5/20 (25%)
leucine-rich repeat 539..562 CDD:275380 8/22 (36%)
leucine-rich repeat 563..585 CDD:275380 2/21 (10%)
leucine-rich repeat 586..626 CDD:275380 6/40 (15%)
leucine-rich repeat 627..653 CDD:275380 0/25 (0%)
LRRCT 716..772 CDD:214507 21/97 (22%)
LRRNT 796..830 CDD:214470
leucine-rich repeat 812..829 CDD:275380
leucine-rich repeat 833..854 CDD:275380
LRR_8 853..913 CDD:290566
leucine-rich repeat 855..878 CDD:275380
LRR_4 878..918 CDD:289563
leucine-rich repeat 879..902 CDD:275380
leucine-rich repeat 903..926 CDD:275380
leucine-rich repeat 927..953 CDD:275380
TIR 1098..1235 CDD:214587
LRRN2NP_006329.2 leucine-rich repeat 51..69 CDD:275380 4/15 (27%)
LRR_RI 62..288 CDD:238064 67/254 (26%)
LRR 1 70..91 5/23 (22%)
leucine-rich repeat 71..94 CDD:275380 5/25 (20%)
LRR 2 94..115 6/22 (27%)
leucine-rich repeat 95..118 CDD:275380 7/24 (29%)
LRR_8 117..177 CDD:290566 24/83 (29%)
LRR 3 118..139 10/44 (23%)
leucine-rich repeat 119..142 CDD:275380 11/46 (24%)
LRR 4 142..163 6/20 (30%)
leucine-rich repeat 143..166 CDD:275380 8/22 (36%)
LRR_8 165..222 CDD:290566 16/56 (29%)
LRR 5 166..187 7/20 (35%)
leucine-rich repeat 167..190 CDD:275380 7/22 (32%)
LRR 6 190..211 3/20 (15%)
leucine-rich repeat 191..214 CDD:275380 4/22 (18%)
LRR_RI 209..>372 CDD:238064 50/234 (21%)
LRR_8 214..273 CDD:290566 17/58 (29%)
LRR 7 214..235 5/20 (25%)
leucine-rich repeat 215..238 CDD:275380 6/22 (27%)
LRR 8 238..259 5/20 (25%)
leucine-rich repeat 239..262 CDD:275380 5/22 (23%)
LRR 9 262..283 8/20 (40%)
leucine-rich repeat 263..286 CDD:275380 8/22 (36%)
LRR 10 286..305 7/40 (18%)
leucine-rich repeat 287..311 CDD:275380 8/90 (9%)
LRR_8 310..371 CDD:290566 19/65 (29%)
LRR 11 311..333 6/21 (29%)
leucine-rich repeat 312..334 CDD:275380 6/21 (29%)
LRR 12 336..357 6/20 (30%)
leucine-rich repeat 337..360 CDD:275378 7/27 (26%)
leucine-rich repeat 361..373 CDD:275378 6/11 (55%)
TPKR_C2 369..412 CDD:301599 9/42 (21%)
I-set 430..514 CDD:254352 11/36 (31%)
Ig 438..514 CDD:299845 9/28 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24373
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.