DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Obp56h and LOC4578091

DIOPT Version :10

Sequence 1:NP_611448.2 Gene:Obp56h / 37271 FlyBaseID:FBgn0034475 Length:134 Species:Drosophila melanogaster
Sequence 2:XP_317191.2 Gene:LOC4578091 / 4578091 VectorBaseID:AGAMI1_013945 Length:311 Species:Anopheles gambiae


Alignment Length:77 Identity:13/77 - (16%)
Similarity:30/77 - (38%) Gaps:11/77 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 NQVTEADLKEFMASGMQSSAKENLKCYTKCLMEKQ-----------GHLTNGQFNAQAMLDTLKN 87
            |.:.::||:..:.|.:.|........|..||:...           ..|.:..:...||....:.
Mosquito   234 NLINKSDLEPEVRSVLASCTGTQAYDYYSCLLNSPVKEDFRNAFYFHELRSANYGYLAMGKVYEG 298

  Fly    88 VPQIKDKMDEIS 99
            ..::||::.:::
Mosquito   299 PEKVKDELKKLN 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Obp56hNP_611448.2 PhBP 26..128 CDD:214783 13/77 (17%)
LOC4578091XP_317191.2 None

Return to query results.
Submit another query.